Citrus Sinensis ID: 029460

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190---

MNSNTENVRDELDFEFLGNRTGQPYTVQTNIYANGKGDREQRVNLWFDPAADYHLYTILWNHHHIVFYVDDVPIRVYKNSGRAPFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPANCASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPECLAGI

ccccccccccEEEEEECccccccccEEEEEEEEccccccCEEEEcccccccccEEEEEEEcccEEEEEEccCEEEEEEcccccccccccccEEEEECccccccccccccEECccccccEEEEEEEEEECcccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEccccccccccccccccccc

********RDELDFEFLGNRTGQPYTVQTNIYANGKGDREQRVNLWFDPAADYHLYTILWNHHHIVFYVDDVPIRVYKNSGRAPFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPANCASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPECLAGI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNSNTENVRDELDFEFLGNRTGQPYTVQTNIYANGKGDREQRVNLWFDPAADYHLYTILWNHHHIVFYVDDVPIRVYKNSGRAPFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPANCASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPECLAGI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable xyloglucan endotransglucosylase/hydrolase protein 6	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.	probable	Q8LF99

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMZ, chain A
Confidence level:very confident
Coverage over the Query: 3-192
View the alignment between query and template
View the model in PyMOL