Citrus Sinensis ID: 029488

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF
ccccccccccHHHHHHHHHccHHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHcccccccccccccccccEEEEEEccccccccccEEEEcccccHHHHHHHHHHHccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHcccccEEEEEc
****SRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPA*******EGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 1 Probable methyltransferase.probableQ9VEP1
Ribosomal RNA large subunit methyltransferase E Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit.probableO27801
Ribosomal RNA large subunit methyltransferase E Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit.probableO28228

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.16623S rRNA (uridine(2552)-2'-O)-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DOU, chain A
Confidence level:very confident
Coverage over the Query: 20-64,79-190
View the alignment between query and template
View the model in PyMOL