Citrus Sinensis ID: 029488


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF
ccccccccccHHHHHHHHHccHHHHHHHHHHHHHHccccccccEEEEccccccHHHHHHHHHHccccccccccccccccEEEEEEccccccccccEEEEcccccHHHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHcccccEEEEEc
ccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHcccccccccccccccccEEEEEEccccccccccEEEEcccccHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHccEEEEEc
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDlcaapgswsQVLSRklylpaklspdsregdlplivaidlqpmapiegVIQVQGDITNARTAEVVIRHFdgckadlvvcdgapdvtglhdmdEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKmlvktpvyff
mgkasrdkrdiyyrkakeegwrarSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVnkmlvktpvyff
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF
**********IYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKL*****EGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYF*
****SRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLP********EGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF
*******KRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPA********GDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query192 2.2.26 [Sep-21-2011]
Q22031 337 Putative tRNA (cytidine(3 yes no 0.921 0.525 0.650 1e-67
Q54VA8270 Putative tRNA (cytidine(3 yes no 0.901 0.640 0.666 7e-67
Q9UET6 329 Putative tRNA (cytidine(3 yes no 0.890 0.519 0.640 1e-64
O36015285 Putative tRNA (cytidine(3 yes no 0.958 0.645 0.629 3e-64
Q9VEP1 302 Putative tRNA (cytidine(3 yes no 0.973 0.619 0.607 1e-61
Q9VDD9 320 Putative tRNA (cytidine(3 no no 0.968 0.581 0.563 5e-58
P38238 310 tRNA (cytidine(32)/guanos yes no 0.947 0.587 0.569 5e-56
A0B8A1255 Ribosomal RNA large subun yes no 0.786 0.592 0.421 2e-31
Q5BH88 806 AdoMet-dependent rRNA met no no 0.807 0.192 0.431 6e-31
Q52C47 865 AdoMet-dependent rRNA met N/A no 0.859 0.190 0.406 7e-31
>sp|Q22031|TRM7_CAEEL Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Caenorhabditis elegans GN=R74.7 PE=3 SV=3 Back     alignment and function desciption
 Score =  255 bits (652), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 145/186 (77%), Gaps = 9/186 (4%)

Query: 1   MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60
           MGK SRDKRDIYYR AKE  WRARSAFKL+QID+EF I +GV+R VDLCAAPGSWSQVLS
Sbjct: 1   MGKTSRDKRDIYYRLAKENKWRARSAFKLMQIDDEFQILKGVRRAVDLCAAPGSWSQVLS 60

Query: 61  RKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA 120
           ++LY          E     IVAIDLQPMAPI GVIQ+QGDIT+  TA  VI+HF G K+
Sbjct: 61  KRLY---------EEDQEAKIVAIDLQPMAPIPGVIQLQGDITSVDTANQVIKHFSGEKS 111

Query: 121 DLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQV 180
           D+V+CDGAPDVTG+H +DEF+Q++LILA   + +HVLKEGG F+AKIFR +++SLLY Q+
Sbjct: 112 DIVICDGAPDVTGIHSLDEFMQAELILAAFNITSHVLKEGGNFLAKIFRSRNSSLLYAQM 171

Query: 181 NKMLVK 186
            K   K
Sbjct: 172 KKYFKK 177




Probable methyltransferase.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q54VA8|TRM7_DICDI Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Dictyostelium discoideum GN=fsjA PE=3 SV=1 Back     alignment and function description
>sp|Q9UET6|TRM7_HUMAN Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens GN=FTSJ1 PE=1 SV=2 Back     alignment and function description
>sp|O36015|TRM7_SCHPO Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.03c PE=3 SV=1 Back     alignment and function description
>sp|Q9VEP1|TRM71_DROME Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 1 OS=Drosophila melanogaster GN=CG5220 PE=2 SV=1 Back     alignment and function description
>sp|Q9VDD9|TRM72_DROME Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 2 OS=Drosophila melanogaster GN=CG7009 PE=3 SV=1 Back     alignment and function description
>sp|P38238|TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM7 PE=1 SV=1 Back     alignment and function description
>sp|A0B8A1|RLME_METTP Ribosomal RNA large subunit methyltransferase E OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=rlmE PE=3 SV=1 Back     alignment and function description
>sp|Q5BH88|SPB1_EMENI AdoMet-dependent rRNA methyltransferase spb1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb1 PE=3 SV=1 Back     alignment and function description
>sp|Q52C47|SPB1_MAGO7 AdoMet-dependent rRNA methyltransferase SPB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPB1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
225440636 316 PREDICTED: putative ribosomal RNA methyl 0.942 0.572 0.955 4e-97
357446585 316 rRNA methyltransferase-like protein [Med 0.937 0.569 0.95 2e-96
30679168 309 S-adenosyl-L-methionine-dependent methyl 0.937 0.582 0.95 2e-96
255581073 316 ribosomal RNA methyltransferase, putativ 0.937 0.569 0.95 2e-96
297806107 309 hypothetical protein ARALYDRAFT_486954 [ 0.937 0.582 0.95 5e-96
6759446287 cell division-like protein [Arabidopsis 0.937 0.627 0.95 5e-96
224146194 316 predicted protein [Populus trichocarpa] 0.942 0.572 0.950 9e-96
222423600 309 AT5G01230 [Arabidopsis thaliana] 0.937 0.582 0.944 1e-95
356555232 316 PREDICTED: putative ribosomal RNA methyl 0.937 0.569 0.933 2e-95
449439914 316 PREDICTED: putative ribosomal RNA methyl 0.942 0.572 0.933 7e-95
>gi|225440636|ref|XP_002278921.1| PREDICTED: putative ribosomal RNA methyltransferase 1 [Vitis vinifera] gi|297740237|emb|CBI30419.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 173/181 (95%), Positives = 179/181 (98%)

Query: 1   MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60
           MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS
Sbjct: 1   MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60

Query: 61  RKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA 120
           RKL+LPAKLSP SR+GDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAE+VIRHFDGCKA
Sbjct: 61  RKLFLPAKLSPASRDGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAELVIRHFDGCKA 120

Query: 121 DLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQV 180
           DLVVCDGAPDVTGLHDMDEFVQSQLILAGLT+VTHVLK+GGKFIAKIFRGKDTSLLYCQ+
Sbjct: 121 DLVVCDGAPDVTGLHDMDEFVQSQLILAGLTIVTHVLKKGGKFIAKIFRGKDTSLLYCQL 180

Query: 181 N 181
            
Sbjct: 181 K 181




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357446585|ref|XP_003593568.1| rRNA methyltransferase-like protein [Medicago truncatula] gi|355482616|gb|AES63819.1| rRNA methyltransferase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|30679168|ref|NP_851026.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein [Arabidopsis thaliana] gi|26983822|gb|AAN86163.1| putative cell division protein [Arabidopsis thaliana] gi|332002931|gb|AED90314.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255581073|ref|XP_002531352.1| ribosomal RNA methyltransferase, putative [Ricinus communis] gi|223529050|gb|EEF31036.1| ribosomal RNA methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297806107|ref|XP_002870937.1| hypothetical protein ARALYDRAFT_486954 [Arabidopsis lyrata subsp. lyrata] gi|297316774|gb|EFH47196.1| hypothetical protein ARALYDRAFT_486954 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|6759446|emb|CAB69851.1| cell division-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224146194|ref|XP_002325916.1| predicted protein [Populus trichocarpa] gi|222862791|gb|EEF00298.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|222423600|dbj|BAH19769.1| AT5G01230 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356555232|ref|XP_003545938.1| PREDICTED: putative ribosomal RNA methyltransferase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449439914|ref|XP_004137730.1| PREDICTED: putative ribosomal RNA methyltransferase 1-like [Cucumis sativus] gi|449483463|ref|XP_004156599.1| PREDICTED: putative ribosomal RNA methyltransferase 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
TAIR|locus:2150069 309 AT5G01230 [Arabidopsis thalian 0.984 0.611 0.910 1.1e-89
ZFIN|ZDB-GENE-041114-83 323 ftsj1 "FtsJ homolog 1 (E. coli 0.901 0.535 0.694 1.1e-62
DICTYBASE|DDB_G0280483270 fsjA "rRNA (uridine-2'-O-)-met 0.901 0.640 0.666 2.7e-61
RGD|1561061 326 Ftsj1 "FtsJ RNA methyltransfer 0.885 0.521 0.661 2.7e-61
WB|WBGene00011281 337 R74.7 [Caenorhabditis elegans 0.921 0.525 0.650 9e-61
UNIPROTKB|E2REZ9 329 FTSJ1 "Uncharacterized protein 0.885 0.516 0.644 2.4e-60
UNIPROTKB|A0JNB8 307 FTSJ1 "Uncharacterized protein 0.885 0.553 0.644 3.1e-60
UNIPROTKB|Q9UET6 329 FTSJ1 "Putative tRNA (cytidine 0.885 0.516 0.644 8.1e-60
POMBASE|SPAC4F10.03c285 SPAC4F10.03c "tRNA 2'-O-ribose 0.947 0.638 0.617 4.5e-59
FB|FBgn0038471 302 CG5220 [Drosophila melanogaste 0.973 0.619 0.607 2.8e-57
TAIR|locus:2150069 AT5G01230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 895 (320.1 bits), Expect = 1.1e-89, P = 1.1e-89
 Identities = 173/190 (91%), Positives = 182/190 (95%)

Query:     1 MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60
             MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS
Sbjct:     1 MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLS 60

Query:    61 RKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA 120
             R+LYLPAK S +S++GDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA
Sbjct:    61 RQLYLPAKSSAESKDGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKA 120

Query:   121 DLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQV 180
             DLVVCDGAPDVTGLHDMDEFVQSQLILAGLT+VTH+LKEGGKFIAKIFRGKDTSLLYCQ+
Sbjct:   121 DLVVCDGAPDVTGLHDMDEFVQSQLILAGLTIVTHILKEGGKFIAKIFRGKDTSLLYCQL 180

Query:   181 NKMLVKTPVY 190
              K+   T  +
Sbjct:   181 -KLFFPTVTF 189




GO:0001510 "RNA methylation" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA;ISS
GO:0032259 "methylation" evidence=IEA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
ZFIN|ZDB-GENE-041114-83 ftsj1 "FtsJ homolog 1 (E. coli)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280483 fsjA "rRNA (uridine-2'-O-)-methyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|1561061 Ftsj1 "FtsJ RNA methyltransferase homolog 1 (E. coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00011281 R74.7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2REZ9 FTSJ1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A0JNB8 FTSJ1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UET6 FTSJ1 "Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPAC4F10.03c SPAC4F10.03c "tRNA 2'-O-ribose methyltransferase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
FB|FBgn0038471 CG5220 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O28228RLME_ARCFU2, ., 1, ., 1, ., 1, 6, 60.35420.82290.8272yesno
Q73IS9RLME_WOLPM2, ., 1, ., 1, ., 1, 6, 60.34970.85930.8593yesno
Q9VEP1TRM71_DROME2, ., 1, ., 1, ., -0.60730.97390.6192yesno
O36015TRM7_SCHPO2, ., 1, ., 1, ., -0.62900.95830.6456yesno
O27801RLME_METTH2, ., 1, ., 1, ., 1, 6, 60.34400.88020.8009yesno
Q54VA8TRM7_DICDI2, ., 1, ., 1, ., -0.66660.90100.6407yesno
Q4FMX1RLME_PELUB2, ., 1, ., 1, ., 1, 6, 60.36550.89580.8472yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.766
4th Layer2.1.1.1660.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00021478001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (316 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00021307001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (586 aa)
      0.784
GSVIVG00032354001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (252 aa)
     0.745
GSVIVG00038073001
SubName- Full=Putative uncharacterized protein (Chromosome chr14 scaffold_9, whole genome shotg [...] (579 aa)
    0.725
GSVIVG00004404001
SubName- Full=Chromosome undetermined scaffold_690, whole genome shotgun sequence; (823 aa)
     0.695
GSVIVG00028481001
SubName- Full=Chromosome chr7 scaffold_44, whole genome shotgun sequence; (316 aa)
       0.656
GSVIVG00038090001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (182 aa)
       0.640
GSVIVG00037695001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (245 aa)
      0.639
GSVIVG00001176001
SubName- Full=Chromosome chr2 scaffold_113, whole genome shotgun sequence; (605 aa)
       0.611
GSVIVG00010464001
SubName- Full=Chromosome chr17 scaffold_263, whole genome shotgun sequence; (563 aa)
       0.607
GSVIVG00005498001
SubName- Full=Putative uncharacterized protein (Chromosome chr13 scaffold_152, whole genome sho [...] (293 aa)
       0.600

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
COG0293205 COG0293, FtsJ, 23S rRNA methylase [Translation, ri 9e-67
pfam01728177 pfam01728, FtsJ, FtsJ-like methyltransferase 5e-53
TIGR00438188 TIGR00438, rrmJ, cell division protein FtsJ 8e-40
PRK11188209 PRK11188, rrmJ, 23S rRNA methyltransferase J; Prov 2e-24
COG1189245 COG1189, COG1189, Predicted rRNA methylase [Transl 3e-05
>gnl|CDD|223370 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  202 bits (517), Expect = 9e-67
 Identities = 74/182 (40%), Positives = 107/182 (58%), Gaps = 12/182 (6%)

Query: 5   SRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLY 64
           +   RD YY+KAK+EG+R+R+A+KLL+++E+F +F+    VVDL AAPG WSQV ++KL 
Sbjct: 9   AEHLRDPYYKKAKKEGYRSRAAYKLLELNEKFKLFKPGMVVVDLGAAPGGWSQVAAKKL- 67

Query: 65  LPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVV 124
                      G    IVA+D+ PM PI GVI +QGDIT+  T E ++    G   D+V+
Sbjct: 68  -----------GAGGKIVAVDILPMKPIPGVIFLQGDITDEDTLEKLLEALGGAPVDVVL 116

Query: 125 CDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKML 184
            D AP+ +G   +D      L    L     VLK GG F+AK+F+G+D   L   + ++ 
Sbjct: 117 SDMAPNTSGNRSVDHARSMYLCELALEFALEVLKPGGSFVAKVFQGEDFEDLLKALRRLF 176

Query: 185 VK 186
            K
Sbjct: 177 RK 178


Length = 205

>gnl|CDD|216666 pfam01728, FtsJ, FtsJ-like methyltransferase Back     alignment and domain information
>gnl|CDD|232976 TIGR00438, rrmJ, cell division protein FtsJ Back     alignment and domain information
>gnl|CDD|183025 PRK11188, rrmJ, 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>gnl|CDD|224110 COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 192
KOG1099 294 consensus SAM-dependent methyltransferase/cell div 100.0
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 100.0
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 100.0
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 100.0
KOG1098 780 consensus Putative SAM-dependent rRNA methyltransf 99.97
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 99.97
TIGR00438188 rrmJ cell division protein FtsJ. 99.95
KOG3673 845 consensus FtsJ-like RNA methyltransferase [RNA pro 99.89
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.64
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.62
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.59
COG4123248 Predicted O-methyltransferase [General function pr 99.55
PRK14902444 16S rRNA methyltransferase B; Provisional 99.53
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.53
PTZ00146293 fibrillarin; Provisional 99.52
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.49
PRK14903431 16S rRNA methyltransferase B; Provisional 99.48
PRK14901434 16S rRNA methyltransferase B; Provisional 99.48
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.47
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.47
PRK10901427 16S rRNA methyltransferase B; Provisional 99.46
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.45
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 99.45
PLN02233261 ubiquinone biosynthesis methyltransferase 99.45
PRK14904445 16S rRNA methyltransferase B; Provisional 99.44
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.44
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 99.41
PRK04266226 fibrillarin; Provisional 99.41
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.4
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.39
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 99.38
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 99.38
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.38
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.38
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.37
KOG3674 696 consensus FtsJ-like RNA methyltransferase [RNA pro 99.37
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 99.36
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.35
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.35
PLN02244340 tocopherol O-methyltransferase 99.35
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.35
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.34
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.34
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.33
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 99.32
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.32
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.31
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.31
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.31
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.3
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.3
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.3
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 99.3
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.29
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.29
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.27
PRK11207197 tellurite resistance protein TehB; Provisional 99.27
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.25
PRK14967223 putative methyltransferase; Provisional 99.25
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.24
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.23
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.22
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.22
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.22
TIGR00452314 methyltransferase, putative. Known examples to dat 99.22
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.22
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.22
PRK08317241 hypothetical protein; Provisional 99.22
PLN02490340 MPBQ/MSBQ methyltransferase 99.21
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.21
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.21
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.2
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.2
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.2
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.2
PRK14968188 putative methyltransferase; Provisional 99.19
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.19
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.19
PLN02336475 phosphoethanolamine N-methyltransferase 99.19
PRK07402196 precorrin-6B methylase; Provisional 99.19
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 99.18
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.18
PRK06922 677 hypothetical protein; Provisional 99.16
PRK04457262 spermidine synthase; Provisional 99.15
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 99.15
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.14
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.14
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.14
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.12
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.12
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.11
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 99.11
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.11
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.1
PRK00811283 spermidine synthase; Provisional 99.09
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.09
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.09
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.09
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.09
PRK12335287 tellurite resistance protein TehB; Provisional 99.08
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.08
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.07
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.06
PHA03411279 putative methyltransferase; Provisional 99.05
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.05
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.04
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.03
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.02
KOG1271227 consensus Methyltransferases [General function pre 99.02
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.02
PHA03412241 putative methyltransferase; Provisional 99.02
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.01
PLN02336 475 phosphoethanolamine N-methyltransferase 99.01
PRK05785226 hypothetical protein; Provisional 99.0
COG2890280 HemK Methylase of polypeptide chain release factor 99.0
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.99
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.98
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 98.98
PLN02366308 spermidine synthase 98.98
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.97
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 98.96
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.96
PLN03075296 nicotianamine synthase; Provisional 98.96
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.95
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.94
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.89
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.87
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.87
KOG2198375 consensus tRNA cytosine-5-methylases and related e 98.87
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.86
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.86
TIGR03438301 probable methyltransferase. This model represents 98.86
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.85
PLN02672 1082 methionine S-methyltransferase 98.84
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.83
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.81
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.81
PRK03612521 spermidine synthase; Provisional 98.81
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.79
PRK06202232 hypothetical protein; Provisional 98.78
KOG4300252 consensus Predicted methyltransferase [General fun 98.77
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.77
PRK01581374 speE spermidine synthase; Validated 98.75
COG2521287 Predicted archaeal methyltransferase [General func 98.75
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.7
PLN02476278 O-methyltransferase 98.66
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.65
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.65
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 98.65
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.64
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.64
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.63
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.63
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.63
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.61
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.6
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.59
KOG2904328 consensus Predicted methyltransferase [General fun 98.56
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.56
KOG2361264 consensus Predicted methyltransferase [General fun 98.54
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.51
COG1041347 Predicted DNA modification methylase [DNA replicat 98.47
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.46
PLN02823336 spermine synthase 98.44
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.44
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.44
KOG3010261 consensus Methyltransferase [General function pred 98.43
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.42
COG0421282 SpeE Spermidine synthase [Amino acid transport and 98.39
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.38
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.38
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.36
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.36
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.35
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.35
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.32
COG4122219 Predicted O-methyltransferase [General function pr 98.32
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.31
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 98.3
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 98.29
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.28
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.27
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.26
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.25
PLN02589247 caffeoyl-CoA O-methyltransferase 98.24
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.24
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.23
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.21
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.19
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 98.18
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 98.16
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.16
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.15
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.14
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.12
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.12
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.1
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.07
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.07
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 98.07
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 98.06
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.06
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.04
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 98.04
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.0
PRK00536262 speE spermidine synthase; Provisional 98.0
KOG2899288 consensus Predicted methyltransferase [General fun 98.0
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.98
PRK04148134 hypothetical protein; Provisional 97.97
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 97.95
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.94
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.91
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.9
KOG3420185 consensus Predicted RNA methylase [Translation, ri 97.9
COG2933358 Predicted SAM-dependent methyltransferase [General 97.87
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.84
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 97.82
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.78
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.74
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.74
COG2520341 Predicted methyltransferase [General function pred 97.72
COG4076252 Predicted RNA methylase [General function predicti 97.71
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.68
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.58
PF06460 299 NSP13: Coronavirus NSP13; InterPro: IPR009461 This 97.56
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.56
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.54
PRK11524 284 putative methyltransferase; Provisional 97.51
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 97.49
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 97.49
PF14314 675 Methyltrans_Mon: Virus-capping methyltransferase 97.49
KOG0820 315 consensus Ribosomal RNA adenine dimethylase [RNA p 97.45
KOG2940 325 consensus Predicted methyltransferase [General fun 97.43
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.39
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.27
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 97.23
COG4798238 Predicted methyltransferase [General function pred 97.23
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.22
PLN02232160 ubiquinone biosynthesis methyltransferase 97.18
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.06
PRK13699 227 putative methylase; Provisional 96.87
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 96.87
COG3897218 Predicted methyltransferase [General function pred 96.87
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 96.64
KOG3115249 consensus Methyltransferase-like protein [General 96.62
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 96.62
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 96.6
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 96.58
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 96.58
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 96.52
PRK10742250 putative methyltransferase; Provisional 96.46
KOG1331 293 consensus Predicted methyltransferase [General fun 96.45
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 96.42
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 96.41
KOG1269 364 consensus SAM-dependent methyltransferases [Lipid 96.4
PF13679141 Methyltransf_32: Methyltransferase domain 96.39
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 96.38
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 96.21
KOG2671421 consensus Putative RNA methylase [Replication, rec 95.94
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 95.85
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 95.76
KOG2360413 consensus Proliferation-associated nucleolar prote 95.71
KOG2730263 consensus Methylase [General function prediction o 95.55
COG0286 489 HsdM Type I restriction-modification system methyl 95.51
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 95.47
COG4262508 Predicted spermidine synthase with an N-terminal m 95.34
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 95.25
PF12692160 Methyltransf_17: S-adenosyl-L-methionine methyltra 95.2
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 94.54
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 94.54
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 94.39
PF03269177 DUF268: Caenorhabditis protein of unknown function 94.21
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 93.99
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 93.98
KOG1709271 consensus Guanidinoacetate methyltransferase and r 93.79
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 93.79
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 93.72
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 93.68
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 93.67
KOG2651 476 consensus rRNA adenine N-6-methyltransferase [RNA 93.6
KOG3987288 consensus Uncharacterized conserved protein DREV/C 93.6
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 93.27
KOG1562337 consensus Spermidine synthase [Amino acid transpor 93.22
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 92.96
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 92.93
KOG3201201 consensus Uncharacterized conserved protein [Funct 92.86
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 92.74
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 92.73
PF01555 231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 92.38
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 92.14
PHA01634156 hypothetical protein 91.52
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 91.4
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 91.12
PF05206259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 91.01
KOG1209 289 consensus 1-Acyl dihydroxyacetone phosphate reduct 91.0
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 90.62
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 90.62
PRK08177225 short chain dehydrogenase; Provisional 90.58
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 90.42
COG1255129 Uncharacterized protein conserved in archaea [Func 89.13
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 89.02
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 88.74
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 88.65
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 88.6
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 87.91
KOG2078 495 consensus tRNA modification enzyme [RNA processing 87.62
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 87.6
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 87.6
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 87.4
PRK11524284 putative methyltransferase; Provisional 87.35
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 86.55
PRK07806248 short chain dehydrogenase; Provisional 86.42
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 86.18
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 85.71
PF10237162 N6-adenineMlase: Probable N6-adenine methyltransfe 85.65
PRK05993 277 short chain dehydrogenase; Provisional 85.56
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 84.97
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 84.67
TIGR00497 501 hsdM type I restriction system adenine methylase ( 84.63
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 84.47
KOG2920282 consensus Predicted methyltransferase [General fun 84.24
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 84.04
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 83.9
PRK06179 270 short chain dehydrogenase; Provisional 82.59
PRK13699227 putative methylase; Provisional 82.46
PRK07326237 short chain dehydrogenase; Provisional 81.6
PRK10458 467 DNA cytosine methylase; Provisional 81.38
KOG0822 649 consensus Protein kinase inhibitor [Cell cycle con 81.14
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 80.86
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 80.46
PHA03108300 poly(A) polymerase small subunit; Provisional 80.28
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 80.15
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=8.4e-43  Score=277.01  Aligned_cols=186  Identities=75%  Similarity=1.160  Sum_probs=173.1

Q ss_pred             CCCCCCCCCChHHHHHHHhCchhhHHhhHHHHHhHcCcccCCCeEEeEcCCCChHHHHHHHHhCCCCCCCCCCCCCCCCe
Q 029488            1 MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPL   80 (192)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~r~~~kl~~i~~~~~~l~~g~~vLDlG~GpG~~s~~l~~~~~~~~~~~~~~~~~~~~~   80 (192)
                      |||+|+++.|-||++|++.|||.|++|||.++|+.|.+|+--.|++|||++||+|+++|++++...  ++++..  ....
T Consensus         1 MGktskDKRDiYYRlAKe~gwRARSAFKLlqideef~i~~gv~rvVDLCAAPGSWSQvlSrkL~~~--~~~~~~--~~~k   76 (294)
T KOG1099|consen    1 MGKTSKDKRDIYYRLAKENGWRARSAFKLLQIDEEFQIFEGVKRVVDLCAAPGSWSQVLSRKLYKP--LPSSGE--RDKK   76 (294)
T ss_pred             CCCccchhhHHHHHHHHhccchHHhHHHHhhhhhhhhHHhhhhHHhhhhcCCCcHHHHHHHHHhcc--CCCcch--hhcc
Confidence            999999999999999999999999999999999999999999999999999999999999997521  222211  2236


Q ss_pred             EEEEeCCCCCCCCCceEEecccCCchhHHHHHhhcCCCcccEEEeCCCCCCCCCccccHHHHHHHHHHHHHHHHHhcccC
Q 029488           81 IVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEG  160 (192)
Q Consensus        81 V~gvD~~~~~~~~~v~~~~~Di~~~~~~~~~~~~~~~~~~DlV~~d~~~~~~g~~~~~~~~~~~l~~~~l~~a~~~Lkpg  160 (192)
                      |++||+++|.++++|.-+++||+...+...+.+++.+++.|+|+|||+|++.|.|++|++.+.++..++|..+..+||||
T Consensus        77 IVaVDLQ~MaPI~GV~qlq~DIT~~stae~Ii~hfggekAdlVvcDGAPDvTGlHd~DEy~Q~qLllaAl~i~t~Vlk~G  156 (294)
T KOG1099|consen   77 IVAVDLQPMAPIEGVIQLQGDITSASTAEAIIEHFGGEKADLVVCDGAPDVTGLHDLDEYVQAQLLLAALNIATCVLKPG  156 (294)
T ss_pred             EEEEecccCCccCceEEeecccCCHhHHHHHHHHhCCCCccEEEeCCCCCccccccHHHHHHHHHHHHHHHHHhheecCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEEecCCCChHHHHHHHHccCCeeeEE
Q 029488          161 GKFIAKIFRGKDTSLLYCQVNKMLVKTPVY  190 (192)
Q Consensus       161 G~~v~k~~~~~~~~~l~~~l~~~f~~v~~~  190 (192)
                      |.||.|+|++.+...|...|+.+|++|.++
T Consensus       157 g~FVaKifRg~~tslLysql~~ff~kv~~~  186 (294)
T KOG1099|consen  157 GSFVAKIFRGRDTSLLYSQLRKFFKKVTCA  186 (294)
T ss_pred             CeeehhhhccCchHHHHHHHHHHhhceeee
Confidence            999999999999999999999999998764



>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG1098 consensus Putative SAM-dependent rRNA methyltransferase SPB1 [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>KOG3673 consensus FtsJ-like RNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>KOG3674 consensus FtsJ-like RNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF06460 NSP13: Coronavirus NSP13; InterPro: IPR009461 This domain covers the NSP13 region of the coronavirus polyprotein Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14314 Methyltrans_Mon: Virus-capping methyltransferase Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>KOG2360 consensus Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12692 Methyltransf_17: S-adenosyl-L-methionine methyltransferase; PDB: 3IHT_B Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PHA03108 poly(A) polymerase small subunit; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
2nyu_A196 Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) 9e-21
1eiz_A180 Ftsj Rna Methyltransferase Complexed With S- Adenos 9e-16
2plw_A201 Crystal Structure Of A Ribosomal Rna Methyltransfer 4e-09
3dou_A191 Crystal Structure Of Methyltransferase Involved In 1e-07
>pdb|2NYU|A Chain A, Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) Protein In Complex With S-Adenosylmethionine Length = 196 Back     alignment and structure

Iteration: 1

Score = 96.3 bits (238), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 56/157 (35%), Positives = 88/157 (56%), Gaps = 5/157 (3%) Query: 21 WRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPL 80 +R+RSAFKLL+++E I RV+D AAPG+WSQV +K+ A P S G Sbjct: 2 YRSRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNA-AGTDPSSPVG---F 57 Query: 81 IVAIDLQPMAPIEG-VIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDE 139 ++ +DL + P+EG D+T+ RT++ ++ G +AD+++ D AP+ TG D+D Sbjct: 58 VLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDH 117 Query: 140 FVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLL 176 L L L+V +L+ GG F+ K + G + L Sbjct: 118 DRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRL 154
>pdb|1EIZ|A Chain A, Ftsj Rna Methyltransferase Complexed With S- Adenosylmethionine Length = 180 Back     alignment and structure
>pdb|2PLW|A Chain A, Crystal Structure Of A Ribosomal Rna Methyltransferase, Putative, From Plasmodium Falciparum (Pf13_0052) Length = 201 Back     alignment and structure
>pdb|3DOU|A Chain A, Crystal Structure Of Methyltransferase Involved In Cell Division From Thermoplasma Volcanicum Gss1 Length = 191 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 5e-77
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 6e-76
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 7e-73
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 1e-68
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 4e-34
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 5e-20
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 2e-10
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Length = 196 Back     alignment and structure
 Score =  228 bits (583), Expect = 5e-77
 Identities = 52/164 (31%), Positives = 87/164 (53%), Gaps = 5/164 (3%)

Query: 21  WRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPL 80
           +R+RSAFKLL+++E   I     RV+D  AAPG+WSQV  +K+                 
Sbjct: 2   YRSRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPV----GF 57

Query: 81  IVAIDLQPMAPIEGVIQ-VQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDE 139
           ++ +DL  + P+EG       D+T+ RT++ ++    G +AD+++ D AP+ TG  D+D 
Sbjct: 58  VLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDH 117

Query: 140 FVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKM 183
                L L  L+V   +L+ GG F+ K + G  +  L  ++ + 
Sbjct: 118 DRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEE 161


>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Length = 180 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} Length = 191 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Length = 201 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Length = 277 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Length = 300 Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Length = 375 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 100.0
2px2_A269 Genome polyprotein [contains: capsid protein C (co 99.96
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.95
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.94
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 99.94
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 99.94
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 99.93
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.9
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.89
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 99.88
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.87
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.87
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 99.83
3r24_A 344 NSP16, 2'-O-methyl transferase; methyltransferase, 99.77
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 99.74
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.59
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.58
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.58
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 99.55
3lpm_A259 Putative methyltransferase; structural genomics, p 99.54
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.54
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.53
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.52
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.51
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.5
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.5
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.49
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.49
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.48
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.48
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.46
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.46
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.46
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.45
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.44
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.44
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.44
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.44
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.43
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.43
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.43
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.43
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.43
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.42
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.42
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.42
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.42
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.42
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.42
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.41
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.41
3f4k_A257 Putative methyltransferase; structural genomics, P 99.41
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.41
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.41
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.4
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.4
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.4
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.4
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.39
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.39
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.39
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.39
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.39
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.38
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.38
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.38
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.38
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.37
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.37
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.37
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.36
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.36
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.36
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.36
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.36
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.36
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.36
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.36
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.36
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.35
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.35
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.35
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.34
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.34
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.33
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.33
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.33
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 99.32
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.32
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.32
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.32
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.32
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.31
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.31
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.31
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.31
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.31
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 99.31
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.31
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.31
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 99.3
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.3
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.3
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.29
2b25_A336 Hypothetical protein; structural genomics, methyl 99.29
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.29
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.29
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.29
3lcc_A235 Putative methyl chloride transferase; halide methy 99.29
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.29
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.29
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.29
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.29
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.29
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.29
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.29
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 99.29
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.28
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.28
3ege_A 261 Putative methyltransferase from antibiotic biosyn 99.28
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.28
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.28
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.28
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.28
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.27
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.27
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.27
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.27
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.27
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.27
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.26
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.26
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.26
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.26
3ocj_A305 Putative exported protein; structural genomics, PS 99.26
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.25
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.25
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.25
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.25
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.25
2i7c_A283 Spermidine synthase; transferase, structural genom 99.25
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.25
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.25
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.24
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.24
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.24
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.24
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.24
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.23
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.23
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 99.23
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.23
2pt6_A321 Spermidine synthase; transferase, structural genom 99.23
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.22
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.22
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.22
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.22
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.22
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.22
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.22
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.21
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.21
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 99.21
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.21
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.21
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.21
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.2
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.2
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.2
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.2
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.19
2h00_A254 Methyltransferase 10 domain containing protein; st 99.19
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.19
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.19
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.18
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.18
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.18
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.18
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.17
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.17
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.16
2o07_A304 Spermidine synthase; structural genomics, structur 99.16
3k6r_A278 Putative transferase PH0793; structural genomics, 99.16
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 99.16
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.16
2hwk_A320 Helicase NSP2; rossman fold, alpha/beta/alpha, mul 99.16
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.16
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.16
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.16
3cc8_A230 Putative methyltransferase; structural genomics, j 99.15
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.15
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.15
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.14
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 99.14
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.14
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.13
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.13
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.13
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.12
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.12
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.11
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.11
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.11
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.1
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.1
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.1
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.1
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 99.1
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.09
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.09
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.08
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.08
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.08
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.08
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.07
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.07
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.07
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.07
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.06
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.06
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.05
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.05
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.05
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.05
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.05
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.04
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.03
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.02
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.02
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.01
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.99
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.98
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.98
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.98
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.98
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.97
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.96
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.95
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.95
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.95
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.95
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.94
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.94
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.93
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.92
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.91
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.88
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.88
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.88
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.87
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.87
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.84
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.84
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.84
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.83
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.82
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 98.8
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 98.78
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 98.77
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.76
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.7
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.69
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.65
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.61
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.6
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 98.55
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.53
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.52
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.52
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.51
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.47
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.47
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.44
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.42
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.42
3lkd_A 542 Type I restriction-modification system methyltrans 98.39
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.3
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.3
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.29
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.26
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.21
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.2
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 98.19
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.15
3khk_A 544 Type I restriction-modification system methylation 98.14
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 98.12
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.1
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.08
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.05
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.04
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.01
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.01
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 97.97
3ufb_A 530 Type I restriction-modification system methyltran 97.85
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 97.83
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 97.82
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 97.72
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 97.66
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 97.54
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 97.31
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 96.8
3trk_A324 Nonstructural polyprotein; hydrolase; 2.40A {Chiku 96.71
2zig_A 297 TTHA0409, putative modification methylase; methylt 96.59
3iht_A174 S-adenosyl-L-methionine methyl transferase; YP_165 96.52
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 96.49
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 96.48
2zig_A297 TTHA0409, putative modification methylase; methylt 96.36
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 96.32
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 96.25
4gua_A 670 Non-structural polyprotein; viral precursor polypr 96.15
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 96.15
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 96.08
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 96.01
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 95.83
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 95.79
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 95.77
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 95.68
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 95.52
3gms_A340 Putative NADPH:quinone reductase; structural genom 95.43
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 95.39
2oo3_A283 Protein involved in catabolism of external DNA; st 95.38
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 95.34
4e4y_A244 Short chain dehydrogenase family protein; structur 95.33
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 95.29
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 95.25
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 95.19
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 95.18
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 95.12
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 95.06
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 94.96
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 94.94
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 94.93
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 94.78
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 94.76
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 94.69
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 94.68
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 94.63
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 94.6
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 94.56
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 94.55
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 94.36
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 94.27
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 94.26
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 94.21
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 94.16
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 94.1
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 94.04
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 93.92
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 93.89
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 93.78
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 93.47
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 93.03
3me5_A 482 Cytosine-specific methyltransferase; structural ge 92.92
4eye_A342 Probable oxidoreductase; structural genomics, niai 92.91
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 92.79
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 92.57
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 92.56
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 92.56
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 92.27
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 92.18
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 92.13
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 92.11
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 92.08
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 91.91
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 91.89
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 91.82
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 91.72
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 91.18
3mag_A 307 VP39; methylated adenine, methyltransferase, RNA C 91.12
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 90.84
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 90.63
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 90.58
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 90.44
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 90.28
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 90.26
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 90.25
1ooe_A236 Dihydropteridine reductase; structural genomics, P 90.2
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 89.95
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 89.94
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 89.64
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 89.56
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 89.55
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 89.29
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 89.15
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 88.87
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 88.82
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 88.68
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 88.44
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 88.11
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 87.9
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 87.66
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 87.66
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 87.54
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 87.39
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 87.17
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 87.12
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 86.99
3fbg_A346 Putative arginate lyase; structural genomics, unkn 86.96
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 86.8
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 86.8
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 86.11
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 86.07
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 85.84
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 85.62
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 85.37
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 85.32
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 85.11
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 85.02
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 84.99
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 84.78
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 84.11
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 83.95
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 83.89
3krt_A456 Crotonyl COA reductase; structural genomics, prote 83.82
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 83.59
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 83.44
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 83.39
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 83.11
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 82.65
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 82.52
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 82.41
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 82.39
4eso_A255 Putative oxidoreductase; NADP, structural genomics 82.21
3gem_A260 Short chain dehydrogenase; structural genomics, AP 81.76
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 81.71
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 81.57
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 81.47
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 81.25
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 81.15
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 80.87
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 80.84
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 80.83
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 80.18
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
Probab=100.00  E-value=7.9e-33  Score=217.76  Aligned_cols=158  Identities=27%  Similarity=0.380  Sum_probs=141.7

Q ss_pred             HhCchhhHHhhHHHHHhHcCcccCCCeEEeEcCCCChHHHHHHHHhCCCCCCCCCCCCCCCCeEEEEeCCCCCCCCCceE
Q 029488           18 EEGWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQ   97 (192)
Q Consensus        18 ~~~~~~r~~~kl~~i~~~~~~l~~g~~vLDlG~GpG~~s~~l~~~~~~~~~~~~~~~~~~~~~V~gvD~~~~~~~~~v~~   97 (192)
                      .++||+|+++||.+++++|.+++++.+|||||||||+|+.+++++ +              ++|+|+|++++.+.+++.+
T Consensus         2 ~~~yr~Ra~~KL~ei~~~~~~~~~g~~VLDlG~G~G~~s~~la~~-~--------------~~V~gvD~~~~~~~~~v~~   66 (191)
T 3dou_A            2 SLQLRSRAAFKLEFLLDRYRVVRKGDAVIEIGSSPGGWTQVLNSL-A--------------RKIISIDLQEMEEIAGVRF   66 (191)
T ss_dssp             --CTTSHHHHHHHHHHHHHCCSCTTCEEEEESCTTCHHHHHHTTT-C--------------SEEEEEESSCCCCCTTCEE
T ss_pred             CCCCCCcHHHHHHHHHHHcCCCCCCCEEEEEeecCCHHHHHHHHc-C--------------CcEEEEeccccccCCCeEE
Confidence            579999999999999999999999999999999999999999987 3              7999999999988889999


Q ss_pred             EecccCCchhHHHHHhhcC---CCcccEEEeCCCCCCCCCccccHHHHHHHHHHHHHHHHHhcccCCEEEEEecCCCChH
Q 029488           98 VQGDITNARTAEVVIRHFD---GCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTS  174 (192)
Q Consensus        98 ~~~Di~~~~~~~~~~~~~~---~~~~DlV~~d~~~~~~g~~~~~~~~~~~l~~~~l~~a~~~LkpgG~~v~k~~~~~~~~  174 (192)
                      +++|+++......+.+.++   .++||+|+||++++..|.+..++..+..+...++..+.++|||||.|++++|.+.+..
T Consensus        67 ~~~D~~~~~~~~~~~~~~~~~~~~~~D~Vlsd~~~~~~g~~~~d~~~~~~l~~~~l~~a~~~LkpGG~lv~k~~~~~~~~  146 (191)
T 3dou_A           67 IRCDIFKETIFDDIDRALREEGIEKVDDVVSDAMAKVSGIPSRDHAVSYQIGQRVMEIAVRYLRNGGNVLLKQFQGDMTN  146 (191)
T ss_dssp             EECCTTSSSHHHHHHHHHHHHTCSSEEEEEECCCCCCCSCHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEECSTHHH
T ss_pred             EEccccCHHHHHHHHHHhhcccCCcceEEecCCCcCCCCCcccCHHHHHHHHHHHHHHHHHHccCCCEEEEEEcCCCCHH
Confidence            9999999876665555554   1399999999999988988888888888888999999999999999999999999999


Q ss_pred             HHHHHHHccCCeeeEE
Q 029488          175 LLYCQVNKMLVKTPVY  190 (192)
Q Consensus       175 ~l~~~l~~~f~~v~~~  190 (192)
                      .+.+.++.+|++|+++
T Consensus       147 ~~~~~l~~~F~~v~~~  162 (191)
T 3dou_A          147 DFIAIWRKNFSSYKIS  162 (191)
T ss_dssp             HHHHHHGGGEEEEEEE
T ss_pred             HHHHHHHHhcCEEEEE
Confidence            9999999999999875



>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2hwk_A Helicase NSP2; rossman fold, alpha/beta/alpha, multi-domain, hydrolase; 2.45A {Venezuelan equine encephalitis virus} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3trk_A Nonstructural polyprotein; hydrolase; 2.40A {Chikungunya virus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3mag_A VP39; methylated adenine, methyltransferase, RNA CAP analog, poly (A) polymerase, mRNA processing, transcription; HET: SAH 3MA; 1.80A {Vaccinia virus} SCOP: c.66.1.25 PDB: 1bky_A* 1jsz_A* 1v39_A* 1p39_A* 1vp9_A* 2vp3_A* 1eam_A* 1jte_A* 1jtf_A* 4dcg_A* 3mct_A* 1b42_A* 1eqa_A* 1av6_A* 3er9_A* 2gaf_A 3er8_A 2ga9_A* 3erc_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 192
d1ej0a_180 c.66.1.2 (A:) RNA methyltransferase FtsJ {Escheric 2e-36
d2p41a1257 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)- 1e-26
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]
 Score =  123 bits (308), Expect = 2e-36
 Identities = 52/173 (30%), Positives = 81/173 (46%), Gaps = 14/173 (8%)

Query: 20  GWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLP 79
           G R+R+ FKL +I +   +F+    VVDL AAPG WSQ +              + G   
Sbjct: 1   GLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVT------------QIGGKG 48

Query: 80  LIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDE 139
            I+A DL PM PI GV  +QGD  +    + ++      K  +V+ D AP+++G   +D 
Sbjct: 49  RIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDI 108

Query: 140 FVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQVNKMLVKTPVYFF 192
                L+   L +   VL  GG F+ K+F+G+       ++  +  K  V   
Sbjct: 109 PRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTK--VKVR 159


>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 100.0
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 99.85
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.62
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.58
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.57
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.56
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.54
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.52
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.52
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.5
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.49
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.48
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.47
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.47
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.46
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.45
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.45
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.44
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.44
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.44
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.43
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.42
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.42
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.41
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.4
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.4
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.4
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.38
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.38
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.37
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.37
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.36
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.36
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.36
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.35
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.35
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 99.34
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.34
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.31
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.31
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 99.31
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.31
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.28
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.28
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.27
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.26
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.24
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.18
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.18
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.17
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.17
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.17
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.14
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.13
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.13
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.12
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.05
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.04
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.01
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.01
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.98
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.98
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.95
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.94
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.9
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.85
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.83
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.83
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.82
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.76
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.74
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.72
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.7
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.67
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.65
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.65
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.62
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.61
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.58
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.54
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.46
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.44
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.44
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.41
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.39
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 98.36
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.33
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.28
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.16
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.11
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.1
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.09
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.0
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 97.98
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.72
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.42
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.35
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.28
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.28
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 97.27
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.25
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.16
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.11
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.09
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.88
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.69
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 96.5
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 96.49
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.28
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.08
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 96.03
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.86
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.82
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.78
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.78
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.71
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.7
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 95.63
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.6
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.58
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.46
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.15
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.07
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 94.96
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 94.92
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 94.81
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.68
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 93.13
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 92.0
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.11
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 90.16
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 90.0
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 89.67
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 89.66
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 89.22
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 89.05
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 88.3
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 84.94
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 84.85
d1m6ex_ 359 Salicylic acid carboxyl methyltransferase (SAMT) { 84.81
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 84.11
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 83.58
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 83.07
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 81.99
d1id1a_153 Rck domain from putative potassium channel Kch {Es 81.61
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 81.42
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 81.3
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 81.24
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: RNA methyltransferase FtsJ
domain: RNA methyltransferase FtsJ
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=2.3e-37  Score=240.36  Aligned_cols=159  Identities=32%  Similarity=0.501  Sum_probs=151.3

Q ss_pred             CchhhHHhhHHHHHhHcCcccCCCeEEeEcCCCChHHHHHHHHhCCCCCCCCCCCCCCCCeEEEEeCCCCCCCCCceEEe
Q 029488           20 GWRARSAFKLLQIDEEFNIFEGVKRVVDLCAAPGSWSQVLSRKLYLPAKLSPDSREGDLPLIVAIDLQPMAPIEGVIQVQ   99 (192)
Q Consensus        20 ~~~~r~~~kl~~i~~~~~~l~~g~~vLDlG~GpG~~s~~l~~~~~~~~~~~~~~~~~~~~~V~gvD~~~~~~~~~v~~~~   99 (192)
                      |||+|+++||.||+++|.+++++.+||||||+||+|+++++++.+            +.+.|+|+|+.|+.+++++.+++
T Consensus         1 GyrsRaafKL~EI~~k~~l~k~~~~vlDLg~aPGgw~q~~~~~~~------------~~~~v~~vDl~~~~~i~~~~~~~   68 (180)
T d1ej0a_           1 GLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQIG------------GKGRIIACDLLPMDPIVGVDFLQ   68 (180)
T ss_dssp             CCSCHHHHHHHHHHHHHCCCCTTCEEEEESCTTCHHHHHHHHHHC------------TTCEEEEEESSCCCCCTTEEEEE
T ss_pred             CchhHHHHHHHHHHHHhCccCCCCeEEEEeccCCcceEEEEeecc------------ccceEEEeecccccccCCceEee
Confidence            799999999999999999999999999999999999999999886            56899999999999999999999


Q ss_pred             cccCCchhHHHHHhhcCCCcccEEEeCCCCCCCCCccccHHHHHHHHHHHHHHHHHhcccCCEEEEEecCCCChHHHHHH
Q 029488          100 GDITNARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTVVTHVLKEGGKFIAKIFRGKDTSLLYCQ  179 (192)
Q Consensus       100 ~Di~~~~~~~~~~~~~~~~~~DlV~~d~~~~~~g~~~~~~~~~~~l~~~~l~~a~~~LkpgG~~v~k~~~~~~~~~l~~~  179 (192)
                      +|+++......+........+|+|+||++|+.+|.++.|+..+..|..+++..|.++||+||.||+|+|++.....+++.
T Consensus        69 ~d~~~~~~~~~~~~~~~~~~~DlVlSD~ap~~sg~~~~d~~~~~~L~~~~l~~a~~~Lk~gG~fV~K~F~g~~~~~l~~~  148 (180)
T d1ej0a_          69 GDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLRE  148 (180)
T ss_dssp             SCTTSHHHHHHHHHHHTTCCEEEEEECCCCCCCSCHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEESSTTHHHHHHH
T ss_pred             cccccchhhhhhhhhccCcceeEEEecccchhcccchhHHHHHHHHHHHHHHhhhhccCCCCcEEEEEecCccHHHHHHH
Confidence            99999888777777777789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHccCCeeeEE
Q 029488          180 VNKMLVKTPVY  190 (192)
Q Consensus       180 l~~~f~~v~~~  190 (192)
                      ++.+|++|+++
T Consensus       149 l~~~F~~V~~~  159 (180)
T d1ej0a_         149 IRSLFTKVKVR  159 (180)
T ss_dssp             HHHHEEEEEEE
T ss_pred             HHhhcCEEEEE
Confidence            99999999875



>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure