Citrus Sinensis ID: 029497

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MAASLATQSMLASPVAARVTGIRRSGANQLSSVKYLPSLRRNVNLSVRCTAEDEQQQQQKDDQPTIPKAEPQPPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV
cccHHHHHHHHHcccccHHccccccccccccccccccccccccccEEEECcccHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccc
**********************************YL********************************************TGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASLATQSMLASPVAARVTGIRRSGANQLSSVKYLPSLRRNVNLSVRCTAEDEQQQQQKDDQPTIPKAEPQPPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Early light-induced protein, chloroplastic Probably involved in the integration of pigments into the mature pigment-protein complexes.probableP11432

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain 3
Confidence level:confident
Coverage over the Query: 90-192
View the alignment between query and template
View the model in PyMOL