Citrus Sinensis ID: 029499


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MGGGTEAFPDLGSHCQHQDCHQLDFLPFKCDGCHKVFCFEHRSFKSHECPKSDIKSRKVIVCEVCSVSIETTGEFGEGEKTMLEKHKKSGDCDPRKQKKPSCPVKRCKEKLTFSNTATCKTCNLKVCLKHRFPADHSCKKDSLLGKNAAADAAVGKGRWNDKFLFALASRNGKECSKCDRGSSSSSPSVKAY
cccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccc
****T*A*PDLGSHCQHQDCHQLDFLPFKCDGCHKVFCFEHRSFKSHECPKSDIKSRKVIVCEVCSVSIETTG*********************************CKEKLTFSNTATCKTCNLKVCLKHRFPADHSCKK****************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGGTEAFPDLGSHCQHQDCHQLDFLPFKCDGCHKVFCFEHRSFKSHECPKSDIKSRKVIVCEVCSVSIETTGEFGEGEKTMLEKHKKSGDCDPRKQKKPSCPVKRCKEKLTFSNTATCKTCNLKVCLKHRFPADHSCKKDSLLGKNAAADAAVGKGRWNDKFLFALASRNGKECSKCDRGSSSSSPSVKAY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger AN1 domain-containing stress-associated protein 12 May be involved in environmental stress response.probableQ67YE6
Zinc finger AN1 domain-containing stress-associated protein 17 May be involved in environmental stress response.probableQ6H595

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WFE, chain A
Confidence level:very confident
Coverage over the Query: 97-154
View the alignment between query and template
View the model in PyMOL
Template: 1WYS, chain A
Confidence level:very confident
Coverage over the Query: 5-55
View the alignment between query and template
View the model in PyMOL
Template: 2EE8, chain A
Confidence level:probable
Coverage over the Query: 26-88
View the alignment between query and template
View the model in PyMOL