Citrus Sinensis ID: 029506

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MMVMNSLLSQYNLFVQAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQSQLTI
cccccccccccHHHHHHHHcccccccccccccEEEEccccHHHHHHHHHHHHcccccEEEccccHHHHHHHcccccccccEEEEEccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccEEEccHHHHHccccccHHHHccccccccccccHHHHHHHHccHHHHHHHccc
cccccccccccHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHcccccEEEEccHHEEEccccccccEcccEEEEcccEEEccccccccEEccccccccccHHHHHHHHHccccccHHHcccccccHHccEEEEcHHHHHHHcccccHHHHHccccccccccccccHHHccccHHHHHHHHcc
MMVMNSLLSQYNLFVQAfasdpladldkekTDILMYCTGGIRCDVYSTILrqrgfhnlytlkggvshylenegpvewvgnlfvfdsrlslppsaykpdavsearmigkvpenpfatcyICSSQVRelrhrncanldcnLLFLCCADcvknlrgccclncttapqrrpvlpgyqrykkwhlyrdsevqsqlti
MMVMNSLLSQYNLFVQAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNcttapqrrpvlpgyqrykkwhlyrdsevqsqlti
MMVMNSLLSQYNLFVQAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQSQLTI
******LLSQYNLFVQAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLP***Y****V*EARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYR**********
MMVMNSLLSQYNLFVQAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGK***NPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNC*********************************
MMVMNSLLSQYNLFVQAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRD*********
****NSLLSQYNLFVQAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQSQLT*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVMNSLLSQYNLFVQAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQSQLTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query192 2.2.26 [Sep-21-2011]
F4I933448 Rhodanese-like domain-con yes no 0.880 0.377 0.692 6e-70
Q6ME97320 UPF0176 protein pc0378 OS yes no 0.822 0.493 0.369 2e-30
Q9Z7H1324 UPF0176 protein CPn_0734/ yes no 0.869 0.515 0.372 3e-28
Q252M0325 UPF0176 protein CF0996 OS yes no 0.890 0.526 0.359 8e-28
Q5L7A0326 UPF0176 protein CAB010 OS yes no 0.843 0.496 0.372 3e-27
Q824X8331 UPF0176 protein CCA_00010 yes no 0.843 0.489 0.372 4e-27
Q3KL68327 UPF0176 protein CTA_0680 yes no 0.843 0.495 0.355 2e-26
O84632327 UPF0176 protein CT_627 OS yes no 0.843 0.495 0.355 2e-26
B0B8K2327 UPF0176 protein CTL0891 O yes no 0.843 0.495 0.355 2e-26
B0BA81327 UPF0176 protein CTLon_088 yes no 0.843 0.495 0.355 2e-26
>sp|F4I933|STR8_ARATH Rhodanese-like domain-containing protein 8, chloroplastic OS=Arabidopsis thaliana GN=STR8 PE=2 SV=1 Back     alignment and function desciption
 Score =  263 bits (672), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 146/179 (81%), Gaps = 10/179 (5%)

Query: 20  SDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVEWVG 79
           SDPL ++DKEKTDILMYCTGGIRCDVYST+LRQRGF NLYTLKGGVSHYL+ EG  EWVG
Sbjct: 266 SDPLINVDKEKTDILMYCTGGIRCDVYSTVLRQRGFKNLYTLKGGVSHYLKEEGTAEWVG 325

Query: 80  NLFVFDSRLSLPPSAYKPDAVSEA------RMIGKVPENP----FATCYICSSQVRELRH 129
           NLFVFDSRLSLPP+AY  + V +A         G+ P+ P    FA CY+C+SQV+ELRH
Sbjct: 326 NLFVFDSRLSLPPAAYNDNVVDKAVGDNVVDEAGRTPQTPVDTSFARCYLCNSQVQELRH 385

Query: 130 RNCANLDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQS 188
           RNCANLDCN LFLCCA+CV +L+GCCC +C +AP+ RPVL G +RY+KWH+YRDSE Q+
Sbjct: 386 RNCANLDCNRLFLCCAECVVDLKGCCCSDCISAPRLRPVLHGVKRYEKWHVYRDSEEQN 444

Arabidopsis thaliana (taxid: 3702)
>sp|Q6ME97|Y378_PARUW UPF0176 protein pc0378 OS=Protochlamydia amoebophila (strain UWE25) GN=pc0378 PE=3 SV=1 Back     alignment and function description
>sp|Q9Z7H1|Y734_CHLPN UPF0176 protein CPn_0734/CP_0012/CPj0734/CpB0762 OS=Chlamydia pneumoniae GN=CPn_0734 PE=3 SV=1 Back     alignment and function description
>sp|Q252M0|Y996_CHLFF UPF0176 protein CF0996 OS=Chlamydophila felis (strain Fe/C-56) GN=CF0996 PE=3 SV=1 Back     alignment and function description
>sp|Q5L7A0|Y010_CHLAB UPF0176 protein CAB010 OS=Chlamydophila abortus (strain S26/3) GN=CAB010 PE=3 SV=1 Back     alignment and function description
>sp|Q824X8|Y010_CHLCV UPF0176 protein CCA_00010 OS=Chlamydophila caviae (strain GPIC) GN=CCA_00010 PE=3 SV=1 Back     alignment and function description
>sp|Q3KL68|Y680_CHLTA UPF0176 protein CTA_0680 OS=Chlamydia trachomatis serovar A (strain HAR-13 / ATCC VR-571B) GN=CTA_0680 PE=3 SV=1 Back     alignment and function description
>sp|O84632|Y627_CHLTR UPF0176 protein CT_627 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_627 PE=3 SV=1 Back     alignment and function description
>sp|B0B8K2|Y891_CHLT2 UPF0176 protein CTL0891 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=CTL0891 PE=3 SV=1 Back     alignment and function description
>sp|B0BA81|Y885_CHLTB UPF0176 protein CTLon_0885 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=CTLon_0885 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
359491815 441 PREDICTED: UPF0176 protein pc0378-like [ 0.916 0.399 0.751 1e-76
296088010 367 unnamed protein product [Vitis vinifera] 0.916 0.479 0.751 3e-76
224125832 460 predicted protein [Populus trichocarpa] 0.885 0.369 0.724 1e-73
255546894 314 protein with unknown function [Ricinus c 0.927 0.566 0.709 8e-72
356512944 416 PREDICTED: UPF0176 protein pc0378-like i 0.906 0.418 0.718 1e-71
356512942 437 PREDICTED: UPF0176 protein pc0378-like i 0.906 0.398 0.718 1e-71
356527913 436 PREDICTED: LOW QUALITY PROTEIN: UPF0176 0.906 0.399 0.724 7e-71
297850178 448 predicted protein [Arabidopsis lyrata su 0.875 0.375 0.713 4e-70
334182661 448 rhodanese homology domain-containing pro 0.880 0.377 0.692 3e-68
240254095 446 rhodanese homology domain-containing pro 0.880 0.378 0.692 3e-68
>gi|359491815|ref|XP_002264379.2| PREDICTED: UPF0176 protein pc0378-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 153/177 (86%), Gaps = 1/177 (0%)

Query: 16  QAFASDPLADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPV 75
           +   SDPLA++DKEKTDILMYCTGGIRCDVYS ILRQRGF NLYTLKGGVSHYLE EGP+
Sbjct: 264 EVIVSDPLANVDKEKTDILMYCTGGIRCDVYSAILRQRGFQNLYTLKGGVSHYLEKEGPM 323

Query: 76  EWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPE-NPFATCYICSSQVRELRHRNCAN 134
           EW+GNLFVFDSRLSLPPS YK +AVSE     +V E + FA CYIC+SQ+ ELRHRNCAN
Sbjct: 324 EWIGNLFVFDSRLSLPPSTYKTEAVSETSGAHQVSEGSTFARCYICNSQLHELRHRNCAN 383

Query: 135 LDCNLLFLCCADCVKNLRGCCCLNCTTAPQRRPVLPGYQRYKKWHLYRDSEVQSQLT 191
           LDCNLLFLCC  C+K+LRGCCCL+CT+AP+ RPVLPG+QRYKKW++YRD E+Q+  T
Sbjct: 384 LDCNLLFLCCTQCLKDLRGCCCLDCTSAPRLRPVLPGHQRYKKWYIYRDMELQTNST 440

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296088010|emb|CBI35293.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125832|ref|XP_002329728.1| predicted protein [Populus trichocarpa] gi|222870636|gb|EEF07767.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255546894|ref|XP_002514505.1| protein with unknown function [Ricinus communis] gi|223546404|gb|EEF47905.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|356512944|ref|XP_003525174.1| PREDICTED: UPF0176 protein pc0378-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356512942|ref|XP_003525173.1| PREDICTED: UPF0176 protein pc0378-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356527913|ref|XP_003532550.1| PREDICTED: LOW QUALITY PROTEIN: UPF0176 protein pc0378-like [Glycine max] Back     alignment and taxonomy information
>gi|297850178|ref|XP_002892970.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297338812|gb|EFH69229.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334182661|ref|NP_001185025.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] gi|384950757|sp|F4I933.1|STR8_ARATH RecName: Full=Rhodanese-like domain-containing protein 8, chloroplastic; AltName: Full=Sulfurtransferase 8; Short=AtStr8; Flags: Precursor gi|332191523|gb|AEE29644.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240254095|ref|NP_564039.6| rhodanese homology domain-containing protein [Arabidopsis thaliana] gi|332191522|gb|AEE29643.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
UNIPROTKB|Q2GJC1279 APH_0962 "UPF0176 protein APH_ 0.437 0.301 0.379 2.3e-12
TIGR_CMR|APH_0962279 APH_0962 "rhodanese domain pro 0.437 0.301 0.379 2.3e-12
MGI|MGI:3039624495 Tstd2 "thiosulfate sulfurtrans 0.619 0.240 0.367 2.7e-12
RGD|1310893493 Tstd2 "thiosulfate sulfurtrans 0.619 0.241 0.367 9.2e-12
UNIPROTKB|Q81S00319 BAS1744 "UPF0176 protein BA_18 0.640 0.385 0.344 1.5e-11
TIGR_CMR|BA_1881319 BA_1881 "rhodanese-like domain 0.640 0.385 0.344 1.5e-11
UNIPROTKB|Q71ZT6319 LMOf2365_1403 "UPF0176 protein 0.640 0.385 0.323 1.9e-11
UNIPROTKB|Q83BJ6237 CBU_1512 "Rhodanese-related su 0.416 0.337 0.397 3.5e-11
TIGR_CMR|CBU_1512237 CBU_1512 "rhodanese domain pro 0.416 0.337 0.397 3.5e-11
UNIPROTKB|Q47UT5341 CPS_4798 "UPF0176 protein CPS_ 0.343 0.193 0.449 3.9e-11
UNIPROTKB|Q2GJC1 APH_0962 "UPF0176 protein APH_0962" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
 Score = 167 (63.8 bits), Expect = 2.3e-12, P = 2.3e-12
 Identities = 33/87 (37%), Positives = 52/87 (59%)

Query:    27 DKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVE--WVGNLFVF 84
             DK+   + MYCTGGIRC+  +  L+  GF N+Y LKGG+ +YL++    +  W G+ FVF
Sbjct:   172 DKD-VGVAMYCTGGIRCEKSTAFLKSLGFENVYHLKGGILNYLQSVKGADSLWEGDCFVF 230

Query:    85 DSRLSLPPSAYKPDAVSEARMIGKVPE 111
             D R+++  +    + +   +  GKV E
Sbjct:   231 DERVAVDNNIAPSEDIKCVKCFGKVDE 257
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
TIGR_CMR|APH_0962 APH_0962 "rhodanese domain protein" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
MGI|MGI:3039624 Tstd2 "thiosulfate sulfurtransferase (rhodanese)-like domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310893 Tstd2 "thiosulfate sulfurtransferase (rhodanese)-like domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q81S00 BAS1744 "UPF0176 protein BA_1881/GBAA_1881/BAS1744" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1881 BA_1881 "rhodanese-like domain protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q71ZT6 LMOf2365_1403 "UPF0176 protein LMOf2365_1403" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
UNIPROTKB|Q83BJ6 CBU_1512 "Rhodanese-related sulfurtransferase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1512 CBU_1512 "rhodanese domain protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q47UT5 CPS_4798 "UPF0176 protein CPS_4798" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037029001
SubName- Full=Chromosome chr17 scaffold_85, whole genome shotgun sequence; (439 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00031553001
SubName- Full=Chromosome chr12 scaffold_57, whole genome shotgun sequence; (213 aa)
      • 0.415

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
PRK00142314 PRK00142, PRK00142, putative rhodanese-related sul 2e-36
COG1054308 COG1054, COG1054, Predicted sulfurtransferase [Gen 9e-28
cd01518101 cd01518, RHOD_YceA, Member of the Rhodanese Homolo 2e-20
PRK01415247 PRK01415, PRK01415, hypothetical protein; Validate 2e-11
PRK05320257 PRK05320, PRK05320, rhodanese superfamily protein; 2e-09
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 2e-07
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 4e-06
cd0152490 cd01524, RHOD_Pyr_redox, Member of the Rhodanese H 2e-04
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 2e-04
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 0.002
>gnl|CDD|234663 PRK00142, PRK00142, putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information 
 Score =  128 bits (324), Expect = 2e-36
 Identities = 52/146 (35%), Positives = 75/146 (51%), Gaps = 21/146 (14%)

Query: 25  DLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVE--WVGNLF 82
           D  K+K  ++MYCTGGIRC+  S  ++  GF  +Y L+GG+  Y E+       W G L+
Sbjct: 167 DPLKDK-KVVMYCTGGIRCEKASAWMKHEGFKEVYQLEGGIITYGEDPETQGLLWDGKLY 225

Query: 83  VFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFL 142
           VFD R+++P        +++   IG         C+ C +     R+ NCAN  CNLL L
Sbjct: 226 VFDERMAVP--------INDEVPIGH--------CHQCGTP--CDRYVNCANPACNLLIL 267

Query: 143 CCADCVKNLRGCCCLNCTTAPQRRPV 168
            C +C +   GCC   C   P+ R V
Sbjct: 268 QCEECEEKYLGCCSEECCEHPRNRYV 293

Length = 314
>gnl|CDD|223982 COG1054, COG1054, Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|238776 cd01518, RHOD_YceA, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|167229 PRK01415, PRK01415, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|235405 PRK05320, PRK05320, rhodanese superfamily protein; Provisional Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 192
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 100.0
COG1054308 Predicted sulfurtransferase [General function pred 100.0
PRK05320257 rhodanese superfamily protein; Provisional 99.95
PRK01415247 hypothetical protein; Validated 99.92
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.68
PLN02160136 thiosulfate sulfurtransferase 99.61
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.59
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.59
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.55
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.54
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.53
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.51
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.51
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.5
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.48
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.48
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.47
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.47
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.47
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.47
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.44
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.43
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.42
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.41
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.41
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.4
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.39
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.38
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.36
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.35
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.34
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.32
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.32
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.31
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.28
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.28
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.26
PRK07411390 hypothetical protein; Validated 99.23
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.21
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.2
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.18
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.18
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.1
PRK11784345 tRNA 2-selenouridine synthase; Provisional 99.09
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 98.95
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 98.84
PLN02723320 3-mercaptopyruvate sulfurtransferase 98.83
PLN02723320 3-mercaptopyruvate sulfurtransferase 98.82
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 98.77
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 98.73
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 98.66
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 98.66
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 98.55
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 98.19
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 98.12
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 97.39
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 96.95
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 93.57
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 93.04
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 89.0
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 87.64
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 83.37
COG2603334 Predicted ATPase [General function prediction only 81.34
PF15645135 Tox-PLDMTX: Dermonecrotoxin of the Papain-like fol 80.42
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.8e-38  Score=276.50  Aligned_cols=146  Identities=36%  Similarity=0.776  Sum_probs=130.5

Q ss_pred             ccChhhhhcCCCccccccCCCCCC-------------CCCCCeEEEEcCCChhHHHHHHHHHHcCCCcEEEcCcchHhhh
Q 029506            3 VMNSLLSQYNLFVQAFASDPLADL-------------DKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYL   69 (192)
Q Consensus         3 ~rn~~E~~~g~f~gai~~~pl~el-------------~k~~k~IvlyC~~G~Rs~~Aa~~L~~~Gf~~Vy~L~GGi~~w~   69 (192)
                      |||++|+.+||||||+ ++|+.++             .++ ++|||||++|+||++|+.+|+++||++|++|.|||.+|.
T Consensus       133 VR~~~E~~~GhI~GAi-~ip~~~~~~~~~~l~~~~~~~kd-k~IvvyC~~G~Rs~~aa~~L~~~Gf~~V~~L~GGi~~w~  210 (314)
T PRK00142        133 MRNDYEYEIGHFENAI-EPDIETFREFPPWVEENLDPLKD-KKVVMYCTGGIRCEKASAWMKHEGFKEVYQLEGGIITYG  210 (314)
T ss_pred             CCCHHHHhcCcCCCCE-eCCHHHhhhhHHHHHHhcCCCCc-CeEEEECCCCcHHHHHHHHHHHcCCCcEEEecchHHHHH
Confidence            8999999999999999 7775333             245 799999999999999999999999999999999999999


Q ss_pred             hhcCCc--eeeccceEEeeeccCCCCCCCCchhhhhhhcCCCCCCCccccccCCCccccccccccCCCCCCccEEeChhh
Q 029506           70 ENEGPV--EWVGNLFVFDSRLSLPPSAYKPDAVSEARMIGKVPENPFATCYICSSQVRELRHRNCANLDCNLLFLCCADC  147 (192)
Q Consensus        70 ~~~~p~--~~~g~~fVFD~R~~v~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~~nC~n~~C~~l~l~C~~C  147 (192)
                      +...+.  .|+|+|||||.|++++++.                ..++++|+.||+|++.  |.||+|+.||.++++|+.|
T Consensus       211 ~~~~~~~~~w~G~~fVFD~R~~~~~~~----------------~~~~~~c~~cg~~~~~--~~~C~~~~C~~~~~~c~~c  272 (314)
T PRK00142        211 EDPETQGLLWDGKLYVFDERMAVPIND----------------EVPIGHCHQCGTPCDR--YVNCANPACNLLILQCEEC  272 (314)
T ss_pred             HhhccccceeecCCccccCcccCCCCc----------------cccccccccCCCCcch--hhCCCCCCCCCeEeechhh
Confidence            876654  5999999999999998761                3468999999999984  7999999999999999999


Q ss_pred             hhccCCCCChhhhcccCCCCC
Q 029506          148 VKNLRGCCCLNCTTAPQRRPV  168 (192)
Q Consensus       148 ~~~~~~~c~~~C~~~~~~r~~  168 (192)
                      ..++.++||..|..++++++.
T Consensus       273 ~~~~~~~~s~~~~~~~~~~~~  293 (314)
T PRK00142        273 EEKYLGCCSEECCEHPRNRYV  293 (314)
T ss_pred             hHHhcCccCchhcccccCHHH
Confidence            999999999999998887743

>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF15645 Tox-PLDMTX: Dermonecrotoxin of the Papain-like fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
4f67_A265 Three Dimensional Structure Of The Double Mutant Of 1e-08
>pdb|4F67|A Chain A, Three Dimensional Structure Of The Double Mutant Of Upf0176 Protein Lpg2838 From Legionella Pneumophila At The Resolution 1.8a, Northeast Structural Genomics Consortium (Nesg) Target Lgr82 Length = 265 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 2/67 (2%)
Query: 26  LDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLEN--EGPVEWVGNLFV 83
           +DK+   I  +CTGGIRC+  +   ++ GF ++Y L  G+ +YLE+  E    W G  FV
Sbjct: 177 IDKKDKKIAXFCTGGIRCEKTTAYXKELGFEHVYQLHDGILNYLESIPESESLWEGKCFV 236
Query: 84  FDSRLSL 90
           FD R+++
Sbjct: 237 FDDRVAV 243

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 7e-20
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 2e-08
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 2e-08
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 1e-07
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 4e-07
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 2e-06
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 3e-06
1tq1_A129 AT5G66040, senescence-associated family protein; C 3e-06
3r2u_A466 Metallo-beta-lactamase family protein; structural 4e-06
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 4e-06
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 1e-05
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 1e-05
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 3e-05
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 4e-05
1vee_A134 Proline-rich protein family; hypothetical protein, 2e-04
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 4e-04
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Length = 265 Back     alignment and structure
 Score = 83.4 bits (207), Expect = 7e-20
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 23  LADLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVE--WVGN 80
                K+K  I M+CTGGIRC+  +  +++ GF ++Y L  G+ +YLE+    E  W G 
Sbjct: 175 NLIDKKDKK-IAMFCTGGIRCEKTTAYMKELGFEHVYQLHDGILNYLESIPESESLWEGK 233

Query: 81  LFVFDSRLSL 90
            FVFD R+++
Sbjct: 234 CFVFDDRVAV 243
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.88
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.73
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.71
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.7
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.69
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.67
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.67
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.66
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.66
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.66
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.66
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.65
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.61
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.61
1vee_A134 Proline-rich protein family; hypothetical protein, 99.6
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.6
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.58
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.57
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.56
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.55
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.53
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.51
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.49
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.48
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.46
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.45
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.43
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.43
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.41
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.41
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.4
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.4
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.39
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.38
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.38
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.37
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.36
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.35
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.35
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.35
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.34
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.33
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.33
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.31
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.31
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.3
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.28
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.27
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.27
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.26
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.25
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.25
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.25
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.25
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.23
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.2
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.2
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.12
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 98.86
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 98.83
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 98.75
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 98.39
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.35
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 97.35
2f46_A156 Hypothetical protein; structural genomics, joint c 91.35
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
Probab=99.88  E-value=2.7e-23  Score=179.30  Aligned_cols=90  Identities=31%  Similarity=0.670  Sum_probs=81.9

Q ss_pred             ccChhhhhcCCCccccccCCCCCC-------------CCCCCeEEEEcCCChhHHHHHHHHHHcCCCcEEEcCcchHhhh
Q 029506            3 VMNSLLSQYNLFVQAFASDPLADL-------------DKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYL   69 (192)
Q Consensus         3 ~rn~~E~~~g~f~gai~~~pl~el-------------~k~~k~IvlyC~~G~Rs~~Aa~~L~~~Gf~~Vy~L~GGi~~w~   69 (192)
                      ||++.|++.||||||+ ++|+.++             +++ ++||+||++|.||.+|+.+|+++||++||+|+|||.+|.
T Consensus       143 VR~~~Ey~~GHIpGAi-niP~~~~~~~~~~l~~~l~~~kd-k~IVvyC~~G~RS~~Aa~~L~~~Gf~nV~~L~GGi~aW~  220 (265)
T 4f67_A          143 TRNDYEYELGTFKNAI-NPDIENFREFPDYVQRNLIDKKD-KKIAMFCTGGIRCEKTTAYMKELGFEHVYQLHDGILNYL  220 (265)
T ss_dssp             CSCHHHHHHEEETTCB-CCCCSSGGGHHHHHHHHTGGGTT-SCEEEECSSSHHHHHHHHHHHHHTCSSEEEETTHHHHHH
T ss_pred             eCCchHhhcCcCCCCE-eCCHHHHHhhHHHHHHhhhhCCC-CeEEEEeCCChHHHHHHHHHHHcCCCCEEEecCHHHHHH
Confidence            8999999999999999 8887654             345 799999999999999999999999999999999999999


Q ss_pred             hhcCCc--eeeccceEEeeeccCCCCC
Q 029506           70 ENEGPV--EWVGNLFVFDSRLSLPPSA   94 (192)
Q Consensus        70 ~~~~p~--~~~g~~fVFD~R~~v~~~~   94 (192)
                      ++..+.  .|+|+|||||.|++++++.
T Consensus       221 ~~~~~~~~~w~G~~fVFD~R~~~~~~l  247 (265)
T 4f67_A          221 ESIPESESLWEGKCFVFDDRVAVDQKL  247 (265)
T ss_dssp             HHSCTTTCCEEECEECSSTTCEECTTS
T ss_pred             HhcCcccccccCcceeEcCccccccCH
Confidence            987653  6999999999999998765
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 192
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 5e-06
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 4e-05
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Sulfurtransferase GlpE
species: Escherichia coli [TaxId: 562]

 Score = 41.6 bits (97), Expect = 5e-06
 Identities = 10/42 (23%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 35  MYCTGGIRCDVYSTILRQRGFHNLYTLKGGVSHYLENEGPVE 76
           + C  G      +  L Q+G+  +Y++ GG   + + + P E
Sbjct: 63  VMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEAW-QRQFPAE 103
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.68
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.64
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.62
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.61
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.59
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.54
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.54
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.39
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.39
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.28
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.21
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.16
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.15
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.07
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.04
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 98.98
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 98.97
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 98.51
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 98.45
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 98.36
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 81.9
d1jf8a_130 Arsenate reductase ArsC {Staphylococcus aureus [Ta 81.41
d1jl3a_137 Arsenate reductase ArsC {Bacillus subtilis [TaxId: 80.75
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.68  E-value=1.8e-17  Score=123.66  Aligned_cols=72  Identities=22%  Similarity=0.280  Sum_probs=64.8

Q ss_pred             ccChhhhhcCCCccccccCCCC-------------------CCCCCCCeEEEEcCCChhHHHHHHHHHHcCCCcEEEcCc
Q 029506            3 VMNSLLSQYNLFVQAFASDPLA-------------------DLDKEKTDILMYCTGGIRCDVYSTILRQRGFHNLYTLKG   63 (192)
Q Consensus         3 ~rn~~E~~~g~f~gai~~~pl~-------------------el~k~~k~IvlyC~~G~Rs~~Aa~~L~~~Gf~~Vy~L~G   63 (192)
                      ||++.||..|||||++ ++|+.                   .++++ ++||+||.+|.||..++.+|+++||++|++|+|
T Consensus        28 vR~~~e~~~ghi~ga~-~ip~~~~~~~~~~~~~~~~~~~~~~~~~~-~~iv~~C~~G~rs~~a~~~L~~~G~~nv~~l~G  105 (119)
T d1tq1a_          28 VRTPEEFSQGHACGAI-NVPYMNRGASGMSKNTDFLEQVSSHFGQS-DNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVG  105 (119)
T ss_dssp             ESCHHHHHHCCBTTBE-ECCSCCCSTTTCCCTTTHHHHHTTTCCTT-SSEEEEESSCSHHHHHHHHHHHHHCCSEEEEEC
T ss_pred             CCCHHHHHcCCCCCcc-chhhcccccccccccHHHHHHHHHhcCCC-cEEEEEcCCcCcHHHHHHHHHhcccCCeEEecC
Confidence            8999999999999999 77632                   23456 799999999999999999999999999999999


Q ss_pred             chHhhhhhcCCce
Q 029506           64 GVSHYLENEGPVE   76 (192)
Q Consensus        64 Gi~~w~~~~~p~~   76 (192)
                      |+.+|.+.++|++
T Consensus       106 G~~~W~~~g~P~e  118 (119)
T d1tq1a_         106 GYSAWAKNGLPTK  118 (119)
T ss_dssp             CHHHHHHHTCCCC
T ss_pred             hHHHHHHCCCCcc
Confidence            9999999999963
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1jf8a_ c.44.1.1 (A:) Arsenate reductase ArsC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jl3a_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure