Citrus Sinensis ID: 029522


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MAEEEPKKLETETPTEPPPPPSTEPAAPAAAEPPKDVADDKTVIPSPPAEDKPEESKALAVVDKAPEAEPPAGEKSTEGSVNRDAVLARVETEKRISLIRAWEESEKSQAENNRKAAVEAELKKIEEQLEKKKAEYVEKMKNKMALIHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGSAPKKLLSCFGS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
*****************************************************************************************VETEKRISLIRAWEE*********************************************************************AKYRATGSAPKKLLSCFGS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEEPKKLETETPTEPPPPPSTEPAAPAAAEPPKDVADDKTVIPSPPAEDKPEESKALAVVDKAPEAEPPAGEKSTEGSVNRDAVLARVETEKRISLIRAWEESEKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIHKEAEEKRAMIEAKRGEDLLKAEELAAKYRATGSAPKKLLSCFGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Remorin Binds to both simple and complex galacturonides. May be involved in cell-to-cell signaling and molecular transport.probableP93788

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 114-143
View the alignment between query and template
View the model in PyMOL