Citrus Sinensis ID: 029532


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLKGSA
cccHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHcccccccccccccHHHHHHccccEEcccccccccHHHHHHHHHHHccHHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHcccEEEcccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccc
MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFA******PT*LELEQAFHQGKHIAGIAKKLKG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLKGSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flavoprotein WrbA Seems to enhance the formation and/or stability of noncovalent complexes between the trp repressor protein and operator-bearing DNA.probableQ1CHD6
Flavoprotein WrbA Seems to enhance the formation and/or stability of noncovalent complexes between the trp repressor protein and operator-bearing DNA.probableQ1C8L9
Flavoprotein WrbA Seems to enhance the formation and/or stability of noncovalent complexes between the trp repressor protein and operator-bearing DNA.probableQ8ZF61

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B6I, chain A
Confidence level:very confident
Coverage over the Query: 1-189
View the alignment between query and template
View the model in PyMOL