Citrus Sinensis ID: 029532

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLKGSA
cccHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHcccccccccccccHHHHHHccccEEcccccccccHHHHHHHHHHHccHHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHHcccEEEcccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccc
cccHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHcccccccccccccHHHHHHccEEEEccccccccHHHHHHHHHHHHccHHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHccEEEEEccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccc
MYGHVEKLAEEIKKGAssvegveaklwqvpetlpeevlgkmsappksdvpiitpnelaeadgfvfgfptrFGMMAAQFKAFLDATgglwrtqqlagkpagmfystgsqgggqetTALTAITQLVHHGmifvpigytfgagmfemekvkggspygagtfagdgsrqpTELELEQAFHQGKHIAGIAKKLKGSA
MYGHVEKLAEEIkkgassvegveaklwqvPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLKGSA
MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYstgsqgggqettALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLKGSA
*************************LW***********************IITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVK********************************************
MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFA******PT*LELEQAFHQGKHIAGIAKKLKG**
MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLKGSA
MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLKG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLKGSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query192 2.2.26 [Sep-21-2011]
C4XGC2203 Flavoprotein WrbA OS=Desu yes no 0.979 0.926 0.515 4e-48
A8GCS6199 Flavoprotein WrbA OS=Serr yes no 0.973 0.939 0.521 3e-47
B9M4V3205 Flavoprotein WrbA OS=Geob yes no 0.973 0.912 0.523 4e-47
Q8Z7N9198 Flavoprotein WrbA OS=Salm N/A no 0.973 0.944 0.497 9e-47
Q0A961199 Flavoprotein WrbA OS=Alka yes no 0.979 0.944 0.497 1e-46
B1JNA9199 Flavoprotein WrbA OS=Yers yes no 0.973 0.939 0.520 2e-46
Q66BP3199 Flavoprotein WrbA OS=Yers yes no 0.973 0.939 0.520 2e-46
A4TK49199 Flavoprotein WrbA OS=Yers yes no 0.973 0.939 0.520 2e-46
Q1CHD6199 Flavoprotein WrbA OS=Yers yes no 0.973 0.939 0.520 2e-46
A9R7R8199 Flavoprotein WrbA OS=Yers yes no 0.973 0.939 0.520 2e-46
>sp|C4XGC2|WRBA_DESMR Flavoprotein WrbA OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=wrbA PE=3 SV=1 Back     alignment and function desciption
 Score =  190 bits (483), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 100/194 (51%), Positives = 128/194 (65%), Gaps = 6/194 (3%)

Query: 1   MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPK----SDVPIITPNE 56
           +YGHV  +A+ + +G   V G+ A L +VPETL EEV+GKM A       S VP  T  E
Sbjct: 10  LYGHVAAMAQAVAEGVHQVPGMTATLRRVPETLSEEVIGKMGATEAQKALSHVPACTLEE 69

Query: 57  LAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTA 116
           L +AD  VFG PTRFG M  Q + FLDATG +W    L GKP G+F ST +Q GGQETT 
Sbjct: 70  LEDADAIVFGTPTRFGNMCGQMRQFLDATGQIWMRGGLVGKPGGVFCSTATQHGGQETTL 129

Query: 117 LTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFA-GDGSRQPTELELEQAF 175
           ++ I  L+HHGMI V + Y+F AG   +++V GGSPYGA T A GDGSR P+E EL+ A 
Sbjct: 130 MSFIQTLLHHGMIVVGLPYSF-AGQMRLDEVTGGSPYGATTIAGGDGSRMPSENELDAAR 188

Query: 176 HQGKHIAGIAKKLK 189
            QG+HIA + ++L+
Sbjct: 189 FQGRHIADVTRRLR 202

Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) (taxid: 573370)
>sp|A8GCS6|WRBA_SERP5 Flavoprotein WrbA OS=Serratia proteamaculans (strain 568) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|B9M4V3|WRBA_GEOSF Flavoprotein WrbA OS=Geobacter sp. (strain FRC-32) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q8Z7N9|WRBA_SALTI Flavoprotein WrbA OS=Salmonella typhi GN=wrbA PE=3 SV=3 Back     alignment and function description
>sp|Q0A961|WRBA_ALHEH Flavoprotein WrbA OS=Alkalilimnicola ehrlichei (strain MLHE-1) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|B1JNA9|WRBA_YERPY Flavoprotein WrbA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q66BP3|WRBA_YERPS Flavoprotein WrbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|A4TK49|WRBA_YERPP Flavoprotein WrbA OS=Yersinia pestis (strain Pestoides F) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|Q1CHD6|WRBA_YERPN Flavoprotein WrbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=wrbA PE=3 SV=1 Back     alignment and function description
>sp|A9R7R8|WRBA_YERPG Flavoprotein WrbA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=wrbA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
255587934203 Minor allergen Alt a, putative [Ricinus 1.0 0.945 0.953 1e-101
224115142203 predicted protein [Populus trichocarpa] 1.0 0.945 0.953 1e-101
224124152203 predicted protein [Populus trichocarpa] 1.0 0.945 0.953 1e-100
225461209203 PREDICTED: flavoprotein wrbA isoform 1 [ 1.0 0.945 0.947 1e-100
359493919192 PREDICTED: flavoprotein wrbA isoform 2 [ 1.0 1.0 0.947 1e-100
118485421203 unknown [Populus trichocarpa] 1.0 0.945 0.947 1e-100
351720697203 uncharacterized protein LOC100499870 [Gl 1.0 0.945 0.927 2e-99
297799264205 quinone reductase family protein [Arabid 1.0 0.936 0.927 6e-99
351721985203 uncharacterized protein LOC100305601 [Gl 1.0 0.945 0.921 1e-98
255626831199 unknown [Glycine max] 1.0 0.964 0.921 2e-98
>gi|255587934|ref|XP_002534445.1| Minor allergen Alt a, putative [Ricinus communis] gi|223525276|gb|EEF27937.1| Minor allergen Alt a, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/192 (95%), Positives = 190/192 (98%)

Query: 1   MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEA 60
           MYGHVEKLAEEIKKGA+SVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEA
Sbjct: 12  MYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEA 71

Query: 61  DGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAI 120
           DGFVFGFPTRFGMM+AQFKAFLDATGGLWRTQQLAGKPAG+FYSTGSQGGGQETTALTAI
Sbjct: 72  DGFVFGFPTRFGMMSAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQGGGQETTALTAI 131

Query: 121 TQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKH 180
           TQLVHHGM+FVPIGYTFGAGMFEMEKVKGGSPYGAGT+AGDGSRQP+ELELEQAFHQGK+
Sbjct: 132 TQLVHHGMLFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELEQAFHQGKY 191

Query: 181 IAGIAKKLKGSA 192
            AGI KKLKGSA
Sbjct: 192 FAGITKKLKGSA 203

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224115142|ref|XP_002316953.1| predicted protein [Populus trichocarpa] gi|222860018|gb|EEE97565.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124152|ref|XP_002319258.1| predicted protein [Populus trichocarpa] gi|222857634|gb|EEE95181.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225461209|ref|XP_002283286.1| PREDICTED: flavoprotein wrbA isoform 1 [Vitis vinifera] gi|147788048|emb|CAN78237.1| hypothetical protein VITISV_016391 [Vitis vinifera] gi|302143167|emb|CBI20462.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493919|ref|XP_003634692.1| PREDICTED: flavoprotein wrbA isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|118485421|gb|ABK94567.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351720697|ref|NP_001237185.1| uncharacterized protein LOC100499870 [Glycine max] gi|255627281|gb|ACU13985.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297799264|ref|XP_002867516.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297313352|gb|EFH43775.1| quinone reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|351721985|ref|NP_001237740.1| uncharacterized protein LOC100305601 [Glycine max] gi|255626039|gb|ACU13364.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255626831|gb|ACU13760.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
TAIR|locus:2131749205 AT4G27270 [Arabidopsis thalian 1.0 0.936 0.848 2.4e-85
TAIR|locus:2178868207 AT5G58800 [Arabidopsis thalian 0.984 0.913 0.615 1.3e-61
TAIR|locus:2115405273 AT4G36750 [Arabidopsis thalian 0.979 0.688 0.634 2.7e-61
CGD|CAL0003649199 PST3 [Candida albicans (taxid: 0.927 0.894 0.530 1.7e-43
ASPGD|ASPL0000059021204 AN0297 [Emericella nidulans (t 0.927 0.872 0.516 1.2e-42
CGD|CAL0003651288 YCP4 [Candida albicans (taxid: 0.984 0.656 0.5 1.2e-42
UNIPROTKB|P0A8G6198 wrbA [Escherichia coli K-12 (t 0.973 0.944 0.455 7.5e-41
SGD|S000000597247 YCP4 "Protein of unknown funct 0.968 0.753 0.473 1.1e-39
TIGR_CMR|GSU_0804203 GSU_0804 "trp repressor bindin 0.984 0.931 0.466 1.4e-39
UNIPROTKB|G4MTI8204 MGG_01569 "Minor allergen Alt 0.921 0.867 0.478 1.3e-38
TAIR|locus:2131749 AT4G27270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 854 (305.7 bits), Expect = 2.4e-85, P = 2.4e-85
 Identities = 163/192 (84%), Positives = 172/192 (89%)

Query:     1 MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEA 60
             MYGHVEKLA+EI+KGA+SV+GVEA LWQVPETL E+VL KMSAPPKSD PIITPNELAEA
Sbjct:    12 MYGHVEKLAQEIRKGAASVDGVEAILWQVPETLQEDVLSKMSAPPKSDAPIITPNELAEA 71

Query:    61 DGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYXXXXXXXXXXXXALTAI 120
             DGF+FGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAG+FY            ALTAI
Sbjct:    72 DGFIFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGIFYSTGSQGGGQETTALTAI 131

Query:   121 TQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAFHQGKH 180
             TQLVHHGMIFVPIGYTFGAGMFEME VKGGSPYGAGTFAGDGSRQPTELEL QAFHQGK+
Sbjct:   132 TQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTFAGDGSRQPTELELGQAFHQGKY 191

Query:   181 IAGIAKKLKGSA 192
             IA I+KKLKG A
Sbjct:   192 IAAISKKLKGPA 203
GO:0005737 "cytoplasm" evidence=ISM
GO:0010181 "FMN binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
TAIR|locus:2178868 AT5G58800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115405 AT4G36750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0003649 PST3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ASPGD|ASPL0000059021 AN0297 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0003651 YCP4 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P0A8G6 wrbA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
SGD|S000000597 YCP4 "Protein of unknown function" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0804 GSU_0804 "trp repressor binding protein WrbA" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|G4MTI8 MGG_01569 "Minor allergen Alt a 7" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7N3F9WRBA_ECOLUNo assigned EC number0.49730.97390.9444yesno
Q1CHD6WRBA_YERPNNo assigned EC number0.52080.97390.9396yesno
Q1C8L9WRBA_YERPANo assigned EC number0.52080.97390.9396yesno
B7UNY7WRBA_ECO27No assigned EC number0.49730.97390.9444yesno
Q0T630WRBA_SHIF8No assigned EC number0.49730.97390.9444yesno
B7LFB3WRBA_ECO55No assigned EC number0.49730.97390.9444yesno
Q8ZF61WRBA_YERPENo assigned EC number0.52080.97390.9396yesno
A1A9Q9WRBA_ECOK1No assigned EC number0.49730.97390.9444yesno
Q32HQ6WRBA_SHIDSNo assigned EC number0.49730.97390.9444yesno
B5F202WRBA_SALA4No assigned EC number0.49210.97390.9444yesno
Q1RDL3WRBA_ECOUTNo assigned EC number0.49730.97390.9444yesno
A4W916WRBA_ENT38No assigned EC number0.52600.96870.9393yesno
A8GCS6WRBA_SERP5No assigned EC number0.52100.97390.9396yesno
B4TSN0WRBA_SALSVNo assigned EC number0.49210.97390.9444yesno
C4ZQD2WRBA_ECOBWNo assigned EC number0.49730.97390.9444yesno
B1X9C5WRBA_ECODHNo assigned EC number0.49730.97390.9444yesno
Q39XL1WRBA_GEOMGNo assigned EC number0.52300.98430.9310yesno
B6I980WRBA_ECOSENo assigned EC number0.49730.97390.9444yesno
A7FJ02WRBA_YERP3No assigned EC number0.52080.97390.9396yesno
B7NLC1WRBA_ECO7INo assigned EC number0.49730.97390.9444yesno
B7M8Y8WRBA_ECO8ANo assigned EC number0.49730.97390.9444yesno
B2K198WRBA_YERPBNo assigned EC number0.52080.97390.9396yesno
Q0A961WRBA_ALHEHNo assigned EC number0.49730.97910.9447yesno
Q8ZQ40WRBA_SALTYNo assigned EC number0.49210.97390.9444yesno
A4TK49WRBA_YERPPNo assigned EC number0.52080.97390.9396yesno
B5R6H0WRBA_SALG2No assigned EC number0.49210.97390.9444yesno
P0A8G7WRBA_ECOL6No assigned EC number0.49730.97390.9444yesno
A7ZYV7WRBA_ECOHSNo assigned EC number0.49730.97390.9444yesno
B7LP27WRBA_ESCF3No assigned EC number0.49730.97390.9444yesno
Q0TJ63WRBA_ECOL5No assigned EC number0.49730.97390.9444yesno
B1IV93WRBA_ECOLCNo assigned EC number0.49730.97390.9444yesno
B9M4V3WRBA_GEOSFNo assigned EC number0.52330.97390.9121yesno
P0A8G8WRBA_SHIFLNo assigned EC number0.49730.97390.9444yesno
C0Q886WRBA_SALPCNo assigned EC number0.49210.97390.9444yesno
B1LJ00WRBA_ECOSMNo assigned EC number0.49730.97390.9444yesno
A7ZKA9WRBA_ECO24No assigned EC number0.49730.97390.9444yesno
B5R056WRBA_SALEPNo assigned EC number0.49210.97390.9444yesno
C4XGC2WRBA_DESMRNo assigned EC number0.51540.97910.9261yesno
B1JNA9WRBA_YERPYNo assigned EC number0.52080.97390.9396yesno
B4T2V2WRBA_SALNSNo assigned EC number0.49210.97390.9444yesno
Q3Z3B7WRBA_SHISSNo assigned EC number0.49730.97390.9303yesno
A9R7R8WRBA_YERPGNo assigned EC number0.52080.97390.9396yesno
Q66BP3WRBA_YERPSNo assigned EC number0.52080.97390.9396yesno
B5XXP0WRBA_KLEP3No assigned EC number0.51560.96870.9393yesno
B5FR47WRBA_SALDCNo assigned EC number0.49210.97390.9444yesno
B7MIE9WRBA_ECO45No assigned EC number0.49730.97390.9444yesno
B4TEP2WRBA_SALHSNo assigned EC number0.49210.97390.9444yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XI0270
hypothetical protein (204 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
PRK03767200 PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase 1e-82
TIGR01755197 TIGR01755, flav_wrbA, NAD(P)H:quinone oxidoreducta 6e-68
COG0655207 COG0655, WrbA, Multimeric flavodoxin WrbA [General 1e-46
pfam03358151 pfam03358, FMN_red, NADPH-dependent FMN reductase 2e-16
pfam00258142 pfam00258, Flavodoxin_1, Flavodoxin 4e-10
COG0431184 COG0431, COG0431, Predicted flavoprotein [General 0.001
pfam02525192 pfam02525, Flavodoxin_2, Flavodoxin-like fold 0.003
>gnl|CDD|179647 PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information 
 Score =  242 bits (621), Expect = 1e-82
 Identities = 100/191 (52%), Positives = 126/191 (65%), Gaps = 2/191 (1%)

Query: 1   MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEA 60
           MYGH+E +AE + +GA  V G E  + +VPET+PEEV  K         P+ TP+ELA+ 
Sbjct: 11  MYGHIETMAEAVAEGAREVAGAEVTIKRVPETVPEEVAKKAGGKTDQAAPVATPDELADY 70

Query: 61  DGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAI 120
           D  +FG PTRFG MA Q + FLD TGGLW    L GK   +F STG+Q GGQETT  +  
Sbjct: 71  DAIIFGTPTRFGNMAGQMRNFLDQTGGLWAKGALVGKVGSVFTSTGTQHGGQETTITSTH 130

Query: 121 TQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFA-GDGSRQPTELELEQAFHQGK 179
           T L+HHGM+ V + Y F  G  ++++V GGSPYGA T A GDGSRQP+E EL  A +QG+
Sbjct: 131 TTLLHHGMVIVGLPYAF-QGQMDVDEVTGGSPYGATTIAGGDGSRQPSENELAGARYQGR 189

Query: 180 HIAGIAKKLKG 190
           H+A IA KL G
Sbjct: 190 HVAEIAAKLAG 200

Length = 200
>gnl|CDD|130816 TIGR01755, flav_wrbA, NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information
>gnl|CDD|223728 COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>gnl|CDD|217511 pfam03358, FMN_red, NADPH-dependent FMN reductase Back     alignment and domain information
>gnl|CDD|215823 pfam00258, Flavodoxin_1, Flavodoxin Back     alignment and domain information
>gnl|CDD|223508 COG0431, COG0431, Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>gnl|CDD|217085 pfam02525, Flavodoxin_2, Flavodoxin-like fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 192
TIGR01755197 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV. 100.0
PRK03767200 NAD(P)H:quinone oxidoreductase; Provisional 100.0
KOG3135203 consensus 1,4-benzoquinone reductase-like; Trp rep 100.0
COG0655207 WrbA Multimeric flavodoxin WrbA [General function 99.96
PRK05569141 flavodoxin; Provisional 99.91
PRK05568142 flavodoxin; Provisional 99.91
PRK11921394 metallo-beta-lactamase/flavodoxin domain-containin 99.91
PRK06756148 flavodoxin; Provisional 99.9
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; 99.9
TIGR01753140 flav_short flavodoxin, short chain. Flavodoxins ar 99.89
PRK06703151 flavodoxin; Provisional 99.87
COG0426388 FpaA Uncharacterized flavoproteins [Energy product 99.87
PRK06242150 flavodoxin; Provisional 99.87
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 99.86
PRK07308146 flavodoxin; Validated 99.86
TIGR03566174 FMN_reduc_MsuE FMN reductase, MsuE subfamily. Memb 99.84
PRK10569191 NAD(P)H-dependent FMN reductase; Provisional 99.83
TIGR03567171 FMN_reduc_SsuE FMN reductase, SsuE family. Members 99.8
PRK09267169 flavodoxin FldA; Validated 99.74
PRK00170201 azoreductase; Reviewed 99.74
TIGR02690219 resist_ArsH arsenical resistance protein ArsH. Mem 99.73
PRK01355199 azoreductase; Reviewed 99.72
PRK09271160 flavodoxin; Provisional 99.7
PRK09739199 hypothetical protein; Provisional 99.68
TIGR01752167 flav_long flavodoxin, long chain. Flavodoxins are 99.67
PRK13556208 azoreductase; Provisional 99.67
PRK12359172 flavodoxin FldB; Provisional 99.66
PRK06934221 flavodoxin; Provisional 99.63
TIGR01754140 flav_RNR ribonucleotide reductase-associated flavo 99.6
PF02525199 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR0 99.55
PF12682156 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A. 99.55
PF00258143 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This 99.53
PRK13555208 azoreductase; Provisional 99.51
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 99.48
COG0431184 Predicted flavoprotein [General function predictio 99.47
PF12724143 Flavodoxin_5: Flavodoxin domain 99.46
PRK07116160 flavodoxin; Provisional 99.44
PRK09004146 FMN-binding protein MioC; Provisional 99.43
PF12641160 Flavodoxin_3: Flavodoxin domain 99.35
COG0716151 FldA Flavodoxins [Energy production and conversion 99.34
KOG4530199 consensus Predicted flavoprotein [General function 99.33
PRK04930184 glutathione-regulated potassium-efflux system anci 99.32
COG1182202 AcpD Acyl carrier protein phosphodiesterase [Lipid 99.29
PRK08105149 flavodoxin; Provisional 99.26
PRK00871176 glutathione-regulated potassium-efflux system anci 99.22
COG2249189 MdaB Putative NADPH-quinone reductase (modulator o 99.21
COG4635175 HemG Flavodoxin [Energy production and conversion 99.1
PRK05723151 flavodoxin; Provisional 98.99
PRK10953 600 cysJ sulfite reductase subunit alpha; Provisional 98.86
TIGR01931 597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 98.79
TIGR00333125 nrdI ribonucleoside-diphosphate reductase 2, opero 98.47
PRK03600134 nrdI ribonucleotide reductase stimulatory protein; 98.39
PRK02551154 flavoprotein NrdI; Provisional 96.26
KOG1159 574 consensus NADP-dependent flavoprotein reductase [E 95.07
PF07972122 Flavodoxin_NdrI: NrdI Flavodoxin like ; InterPro: 94.59
COG1780141 NrdI Protein involved in ribonucleotide reduction 92.93
COG1445122 FrwB Phosphotransferase system fructose-specific c 87.43
COG0369 587 CysJ Sulfite reductase, alpha subunit (flavoprotei 85.99
COG1440102 CelA Phosphotransferase system cellobiose-specific 83.44
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 81.53
>TIGR01755 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information 
Probab=100.00  E-value=1.4e-35  Score=226.01  Aligned_cols=187  Identities=52%  Similarity=0.881  Sum_probs=158.5

Q ss_pred             CCCHHHHHHHHHHHhccccCCceeEEEEcCCCCCHHHhcccCCCCCCCCCCCChhHhhhCCEEEEeccccCCCchHHHHH
Q 029532            1 MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFKA   80 (192)
Q Consensus         1 ~~GnT~~la~~i~~~l~~~~g~ev~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aD~ii~gsP~y~g~~~~~~k~   80 (192)
                      +||||++||+++++++++..|++++++++.+..+.+++.+..+...++.|....+++.+||+||||||+|+++++++||.
T Consensus        10 ~~G~T~~lA~~ia~g~~~~~g~ev~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aD~ii~GSPty~g~~~~~lk~   89 (197)
T TIGR01755        10 MYGHIETMARAVAEGAREVDGAEVVVKRVPETVPEEVAEKSHGKTDQTAPVATPQELADYDAIIFGTPTRFGNMASQMRN   89 (197)
T ss_pred             CCCHHHHHHHHHHHHHHhcCCCEEEEEeccccCcHHHHHhccCCcccCCccCCHHHHHHCCEEEEEecccccCccHHHHH
Confidence            68999999999999998623899999999887666666544333334445444688999999999999999999999999


Q ss_pred             HHHhhccccccCCCCCCcEEEEEecCCCCCChHHHHHHHHHHHHHcCCEEecCCccCCCCccccccccCCCCCccceecC
Q 029532           81 FLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAG  160 (192)
Q Consensus        81 fld~~~~~~~~~~l~gK~~~~~~s~g~~~g~~~~~l~~~~~~l~~~g~~vv~~~~~~~~~~~~~~~~~~~~~~g~~~~~~  160 (192)
                      |+|++..+|....+.||++++|+++||.+|+.+.++..+...|..+||.+|+.++.+. ..+..+..++|++||+.+..+
T Consensus        90 fld~~~~~~~~~~l~gK~~~~f~s~g~~~Gg~~~~l~~l~~~l~~~Gm~vv~~~~~~~-~~~~~~~~~gg~~~G~~~~~~  168 (197)
T TIGR01755        90 FLDQTGGLWASGALVGKVGSVFTSTGTQHGGQESTILSTWTTLLHHGMIIVPLPYAAQ-EQMGVDEVRGGSPYGATTIAG  168 (197)
T ss_pred             HHHhccccccccccCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEeCCCcccc-cccccccccCCCCcceeeEcC
Confidence            9999988886668999999999999998888888999999999999999999877653 223344568899999999987


Q ss_pred             -CCCCCCCHHHHHHHHHHHHHHHHHHHHh
Q 029532          161 -DGSRQPTELELEQAFHQGKHIAGIAKKL  188 (192)
Q Consensus       161 -~~~~~p~~~~~~~~~~lg~~la~~~~~~  188 (192)
                       +++..|++.+++.++.+|+|+|+.+++|
T Consensus       169 ~~~~~~p~~~d~~~a~~~g~r~a~~a~~l  197 (197)
T TIGR01755       169 GDGSRQPSAEELDIARYQGRHVAGLAAKL  197 (197)
T ss_pred             CCCCCCcCHHHHHHHHHHHHHHHHHHHhC
Confidence             7778899999999999999999999875

This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected.
>PRK03767 NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information
>KOG3135 consensus 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein [General function prediction only] Back     alignment and domain information
>COG0655 WrbA Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>PRK05569 flavodoxin; Provisional Back     alignment and domain information
>PRK05568 flavodoxin; Provisional Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>TIGR01753 flav_short flavodoxin, short chain Back     alignment and domain information
>PRK06703 flavodoxin; Provisional Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PRK06242 flavodoxin; Provisional Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>PRK07308 flavodoxin; Validated Back     alignment and domain information
>TIGR03566 FMN_reduc_MsuE FMN reductase, MsuE subfamily Back     alignment and domain information
>PRK10569 NAD(P)H-dependent FMN reductase; Provisional Back     alignment and domain information
>TIGR03567 FMN_reduc_SsuE FMN reductase, SsuE family Back     alignment and domain information
>PRK09267 flavodoxin FldA; Validated Back     alignment and domain information
>PRK00170 azoreductase; Reviewed Back     alignment and domain information
>TIGR02690 resist_ArsH arsenical resistance protein ArsH Back     alignment and domain information
>PRK01355 azoreductase; Reviewed Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information
>PRK09739 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01752 flav_long flavodoxin, long chain Back     alignment and domain information
>PRK13556 azoreductase; Provisional Back     alignment and domain information
>PRK12359 flavodoxin FldB; Provisional Back     alignment and domain information
>PRK06934 flavodoxin; Provisional Back     alignment and domain information
>TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative Back     alignment and domain information
>PF02525 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR003680 This family consists of a domain with a flavodoxin-like fold Back     alignment and domain information
>PF12682 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A Back     alignment and domain information
>PF00258 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This domain is found in a number of proteins including flavodoxin and nitric-oxide synthase Back     alignment and domain information
>PRK13555 azoreductase; Provisional Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>COG0431 Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>PF12724 Flavodoxin_5: Flavodoxin domain Back     alignment and domain information
>PRK07116 flavodoxin; Provisional Back     alignment and domain information
>PRK09004 FMN-binding protein MioC; Provisional Back     alignment and domain information
>PF12641 Flavodoxin_3: Flavodoxin domain Back     alignment and domain information
>COG0716 FldA Flavodoxins [Energy production and conversion] Back     alignment and domain information
>KOG4530 consensus Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>PRK04930 glutathione-regulated potassium-efflux system ancillary protein KefG; Provisional Back     alignment and domain information
>COG1182 AcpD Acyl carrier protein phosphodiesterase [Lipid metabolism] Back     alignment and domain information
>PRK08105 flavodoxin; Provisional Back     alignment and domain information
>PRK00871 glutathione-regulated potassium-efflux system ancillary protein KefF; Provisional Back     alignment and domain information
>COG2249 MdaB Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only] Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>PRK05723 flavodoxin; Provisional Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>TIGR00333 nrdI ribonucleoside-diphosphate reductase 2, operon protein nrdI Back     alignment and domain information
>PRK03600 nrdI ribonucleotide reductase stimulatory protein; Reviewed Back     alignment and domain information
>PRK02551 flavoprotein NrdI; Provisional Back     alignment and domain information
>KOG1159 consensus NADP-dependent flavoprotein reductase [Energy production and conversion] Back     alignment and domain information
>PF07972 Flavodoxin_NdrI: NrdI Flavodoxin like ; InterPro: IPR004465 Ribonucleotide reductases (RNRs) are enzymes that provide the precursors of DNA synthesis Back     alignment and domain information
>COG1780 NrdI Protein involved in ribonucleotide reduction [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1445 FrwB Phosphotransferase system fructose-specific component IIB [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1440 CelA Phosphotransferase system cellobiose-specific component IIB [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
3b6i_A198 Wrba From Escherichia Coli, Native Structure Length 3e-41
2zki_A199 Crystal Structure Of Hypothetical Trp Repressor Bin 2e-26
1zwk_A207 Structure Of Wrba From Pseudomonas Aeruginosa Lengt 1e-20
1ydg_A211 Crystal Structure Of Trp Repressor Binding Protein 2e-13
1yrh_A211 Crystal Structure Of Trp Repressor Binding Protein 3e-13
2a5l_A200 The Crystal Structure Of The Trp Repressor Binding 2e-12
2ark_A188 Structure Of A Flavodoxin From Aquifex Aeolicus Len 1e-05
>pdb|3B6I|A Chain A, Wrba From Escherichia Coli, Native Structure Length = 198 Back     alignment and structure 
Iteration: 1

 Score =  164 bits (415), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 120/191 (62%), Gaps = 4/191 (2%)
Query: 1   MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEA 60
           MYGH+E +A  + +GAS V+G E  + +VPET+P ++  K     ++  P+ TP ELA+ 
Sbjct: 11  MYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQT-APVATPQELADY 69
Query: 61  DGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYXXXXXXXXXXXXALTAI 120
           D  +FG PTRFG M+ Q + FLD TGGLW +  L GK A +F               T  
Sbjct: 70  DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITST-W 128
Query: 121 TQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFA-GDGSRQPTELELEQAFHQGK 179
           T L HHGM+ VPIGY     +F++ +V+GG+PYGA T A GDGSRQP++ EL  A +QG+
Sbjct: 129 TTLAHHGMVIVPIGYA-AQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGE 187
Query: 180 HIAGIAKKLKG 190
           ++AG+A KL G
Sbjct: 188 YVAGLAVKLNG 198
>pdb|2ZKI|A Chain A, Crystal Structure Of Hypothetical Trp Repressor Binding Protein From Sul Folobus Tokodaii (St0872) Length = 199 Back     alignment and structure
>pdb|1ZWK|A Chain A, Structure Of Wrba From Pseudomonas Aeruginosa Length = 207 Back     alignment and structure
>pdb|1YDG|A Chain A, Crystal Structure Of Trp Repressor Binding Protein Wrba Length = 211 Back     alignment and structure
>pdb|1YRH|A Chain A, Crystal Structure Of Trp Repressor Binding Protein Wrba In Complex With Fmn Length = 211 Back     alignment and structure
>pdb|2A5L|A Chain A, The Crystal Structure Of The Trp Repressor Binding Protein Wrba From Pseudomonas Aeruginosa Length = 200 Back     alignment and structure
>pdb|2ARK|A Chain A, Structure Of A Flavodoxin From Aquifex Aeolicus Length = 188 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 2e-89
2zki_A199 199AA long hypothetical Trp repressor binding prot 1e-88
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 7e-88
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 8e-87
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 2e-72
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 3e-66
3edo_A151 Flavoprotein, putative Trp repressor binding prote 3e-24
1sqs_A242 Conserved hypothetical protein; structural genomic 2e-15
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 3e-10
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 1e-09
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 1e-08
1rli_A184 Trp repressor binding protein; structural genomics 2e-08
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 3e-08
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 7e-08
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 8e-08
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 2e-07
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 2e-07
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 4e-07
1vme_A410 Flavoprotein; TM0755, structural genomics, JCSG, p 3e-06
2fz5_A137 Flavodoxin; alpha/beta doubly-wound topology, non- 9e-06
3klb_A162 Putative flavoprotein; structural genomi center fo 2e-05
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 9e-05
2fzv_A279 Putative arsenical resistance protein; flavin bind 2e-04
3gfs_A174 FMN-dependent NADPH-azoreductase; flavoproteins, q 3e-04
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Length = 198 Back     alignment and structure
 Score =  259 bits (663), Expect = 2e-89
 Identities = 95/191 (49%), Positives = 129/191 (67%), Gaps = 4/191 (2%)

Query: 1   MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEA 60
           MYGH+E +A  + +GAS V+G E  + +VPET+P ++  K     +   P+ TP ELA+ 
Sbjct: 11  MYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQ-TAPVATPQELADY 69

Query: 61  DGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAI 120
           D  +FG PTRFG M+ Q + FLD TGGLW +  L GK A +F STG+ GGGQE T  +  
Sbjct: 70  DAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGT-GGGQEQTITSTW 128

Query: 121 TQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAG-DGSRQPTELELEQAFHQGK 179
           T L HHGM+ VPIGY     +F++ +V+GG+PYGA T AG DGSRQP++ EL  A +QG+
Sbjct: 129 TTLAHHGMVIVPIGYAA-QELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGE 187

Query: 180 HIAGIAKKLKG 190
           ++AG+A KL G
Sbjct: 188 YVAGLAVKLNG 198
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Length = 199 Back     alignment and structure
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Length = 200 Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Length = 211 Back     alignment and structure
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Length = 193 Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Length = 188 Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Length = 151 Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Length = 242 Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Length = 161 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398 Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Length = 184 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402 Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Length = 138 Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Length = 159 Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Length = 197 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Length = 191 Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein STR initiative, PSI, joint center for structural genomics, ELEC transport; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Length = 410 Back     alignment and structure
>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1 Length = 137 Back     alignment and structure
>3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} Length = 162 Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Length = 247 Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Length = 279 Back     alignment and structure
>3gfs_A FMN-dependent NADPH-azoreductase; flavoproteins, quinone reductase, flavodoxin, oligomerization, flavoprotein, oxidoreductase; HET: FMN; 2.10A {Bacillus subtilis} PDB: 1nni_1* 2gsw_A* 3gfr_A* 3gfq_A* Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 99.97
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 99.97
2zki_A199 199AA long hypothetical Trp repressor binding prot 99.96
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 99.96
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 99.94
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 99.94
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 99.94
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 99.93
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 99.91
2q62_A247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 99.89
1sqs_A242 Conserved hypothetical protein; structural genomic 99.88
2fzv_A279 Putative arsenical resistance protein; flavin bind 99.88
2fz5_A137 Flavodoxin; alpha/beta doubly-wound topology, non- 99.88
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 99.87
3f6r_A148 Flavodoxin; FMN binding, oxidized, electron transp 99.87
1rtt_A193 Conserved hypothetical protein; protein structure 99.87
3fvw_A192 Putative NAD(P)H-dependent FMN reductase; Q8DWD8_s 99.87
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 99.87
4dik_A410 Flavoprotein; TM0755, electron transport, DI-iron 99.86
4hs4_A199 Chromate reductase; triple-layered, A/B/A structur 99.86
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 99.86
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 99.86
1f4p_A147 Flavodoxin; electron transport, flavoprotein, FMN, 99.84
3svl_A193 Protein YIEF; E. coli CHRR enzyme, chromate biorem 99.84
3u7r_A190 NADPH-dependent FMN reductase; alpha/beta twisted 99.84
3gfs_A174 FMN-dependent NADPH-azoreductase; flavoproteins, q 99.83
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.83
1rli_A184 Trp repressor binding protein; structural genomics 99.82
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.82
3s2y_A199 Chromate reductase; uranium reductase, oxidoreduct 99.69
2hpv_A208 FMN-dependent NADH-azoreductase; structural genomi 99.8
1t0i_A191 YLR011WP; FMN binding protein, flavodoxin, azoredu 99.8
1t5b_A201 Acyl carrier protein phosphodiesterase; structural 99.78
1czn_A169 Flavodoxin; FMN binding, redox potential, electron 99.78
2amj_A204 Modulator of drug activity B; oxidoreductase, mena 99.76
1obo_A169 Flavodoxin; electron transfer, flavoprotein, elect 99.76
3lcm_A196 SMU.1420, putative oxidoreductase; NADPH:quinone o 99.74
1ykg_A167 SIR-FP, sulfite reductase [NADPH] flavoprotein alp 99.73
1yob_A179 Flavodoxin 2, flavodoxin II; alpha-beta fold, non- 99.73
3r6w_A212 FMN-dependent NADH-azoreductase 1; nitrofurazone, 99.72
1d4a_A273 DT-diaphorase, quinone reductase; flavoprotein, ro 99.72
2fcr_A173 Flavodoxin; electron transport; HET: FMN; 1.80A {C 99.71
1ag9_A175 Flavodoxin; electron transport, reductive activati 99.71
3p0r_A211 Azoreductase; structural genomics, center for stru 99.7
2wc1_A182 Flavodoxin; electron transport, flavoprotein; HET: 99.7
2hna_A147 Protein MIOC, flavodoxin; alpha-beta sandwich, fla 99.69
3tem_A228 Ribosyldihydronicotinamide dehydrogenase [quinone; 99.68
3f2v_A192 General stress protein 14; alpha-beta protein., st 99.68
3u7i_A223 FMN-dependent NADH-azoreductase 1; structural geno 99.68
3klb_A162 Putative flavoprotein; structural genomi center fo 99.66
3rpe_A218 MDAB, modulator of drug activity B; structural gen 99.66
1bvy_F191 Protein (cytochrome P450 BM-3); fatty acid monooxy 99.64
2bmv_A164 Flavodoxin; electron transport, flavoprotein, FMN, 99.6
3edo_A151 Flavoprotein, putative Trp repressor binding prote 99.57
4ici_A171 Putative flavoprotein; PF12682 family protein, fla 99.56
4gi5_A280 Quinone reductase; protein structure initiative, F 99.56
3ha2_A177 NADPH-quinone reductase; structural genomics, PSI- 99.56
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 99.45
3hr4_A219 Nitric oxide synthase, inducible; inducible nitric 99.4
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 99.35
2xod_A119 NRDI protein, NRDI; flavoprotein, redox protein, r 99.21
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 99.13
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 98.99
3n3a_C153 Protein NRDI; ribonucleotide reductase, four-helix 98.35
1rlj_A139 NRDI protein; flavoprotein, FMN, thioredoxin, alph 98.29
2m1z_A106 LMO0427 protein; homolog PTS system IIB component, 86.15
2kyr_A111 Fructose-like phosphotransferase enzyme IIB compo; 83.99
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 82.27
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Back     alignment and structure
Probab=99.97  E-value=1.1e-29  Score=192.05  Aligned_cols=185  Identities=50%  Similarity=0.866  Sum_probs=142.9

Q ss_pred             CCCHHHHHHHHHHHhccc-cCCceeEEEEcCCCCCHHHhcccCCCCCCCCCCCChhHhhhCCEEEEeccccCCCchHHHH
Q 029532            1 MYGHVEKLAEEIKKGASS-VEGVEAKLWQVPETLPEEVLGKMSAPPKSDVPIITPNELAEADGFVFGFPTRFGMMAAQFK   79 (192)
Q Consensus         1 ~~GnT~~la~~i~~~l~~-~~g~ev~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aD~ii~gsP~y~g~~~~~~k   79 (192)
                      ++|||+++|+++++++++ . |++++++++.+..+...+.....|. +..+....+++.+||+||||||+||+++|++||
T Consensus        11 ~~g~t~~la~~i~~~l~~~~-g~~v~~~~l~~~~~~~~~~~~~~~~-~~~~~~~~~~l~~aD~ii~gsP~y~~~~~~~lk   88 (198)
T 3b6i_A           11 MYGHIETMARAVAEGASKVD-GAEVVVKRVPETMPPQLFEKAGGKT-QTAPVATPQELADYDAIIFGTPTRFGNMSGQMR   88 (198)
T ss_dssp             SSSHHHHHHHHHHHHHHTST-TCEEEEEECCCCSCHHHHHHTTCCC-CCSCBCCGGGGGGCSEEEEEEEEETTEECHHHH
T ss_pred             CCcHHHHHHHHHHHHHhhcC-CCEEEEEEccccCchhhhhhccccc-ccCchhhHHHHHHCCEEEEEeChhcCCchHHHH
Confidence            489999999999999986 4 8899999999875433322222222 111222368999999999999999999999999


Q ss_pred             HHHHhhccccccCCCCCCcEEEEEecCCCCCChHHHHHHHHHHHHHcCCEEecCCccCCCCccccccccCCCCCccceec
Q 029532           80 AFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFA  159 (192)
Q Consensus        80 ~fld~~~~~~~~~~l~gK~~~~~~s~g~~~g~~~~~l~~~~~~l~~~g~~vv~~~~~~~~~~~~~~~~~~~~~~g~~~~~  159 (192)
                      .|||++...|....++||++++|+++||. ++...++..+...+..+||.+++.++.... ......+.++.+||...+.
T Consensus        89 ~~ld~~~~~~~~~~l~~K~~~~~~t~g~~-g~~~~~l~~l~~~l~~~g~~~v~~~~~~~~-~~~~~~~~g~~~~g~~~~~  166 (198)
T 3b6i_A           89 TFLDQTGGLWASGALYGKLASVFSSTGTG-GGQEQTITSTWTTLAHHGMVIVPIGYAAQE-LFDVSQVRGGTPYGATTIA  166 (198)
T ss_dssp             HHHTTCHHHHHHTTTTTCEEEEEEEESSS-TTHHHHHHHHHHHHHHTTCEECCCTTCSGG-GGCCSSCCCCBTTBCEEEC
T ss_pred             HHHHHhhhhhhhcccCCCEEEEEEeCCCC-ccHHHHHHHHHHHHHHCCcEEECCCCCccc-ccccccccCCCCCCcceec
Confidence            99999976554456899999999999987 566778889999999999999987664210 0000113566788887776


Q ss_pred             C-CCCCCCCHHHHHHHHHHHHHHHHHHHHhh
Q 029532          160 G-DGSRQPTELELEQAFHQGKHIAGIAKKLK  189 (192)
Q Consensus       160 ~-~~~~~p~~~~~~~~~~lg~~la~~~~~~~  189 (192)
                      + +++..|+++++++++++|++|++.+++++
T Consensus       167 ~~~~~~~~~~~~~~~a~~~g~~la~~~~~~~  197 (198)
T 3b6i_A          167 GGDGSRQPSQEELSIARYQGEYVAGLAVKLN  197 (198)
T ss_dssp             CTTSCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHhc
Confidence            5 45568999999999999999999998875
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Back     alignment and structure
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Back     alignment and structure
>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1 Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Back     alignment and structure
>3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* Back     alignment and structure
>1rtt_A Conserved hypothetical protein; protein structure initiative, SAD with sulfur, putative REDU PSI; 1.28A {Pseudomonas aeruginosa} SCOP: c.23.5.4 PDB: 1x77_A* Back     alignment and structure
>3fvw_A Putative NAD(P)H-dependent FMN reductase; Q8DWD8_strmu, SMR99, NESG, structural genomics, PSI-2, protein structure initiative; 2.30A {Streptococcus mutans} Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>4hs4_A Chromate reductase; triple-layered, A/B/A structure, NAD(P)H-dependent FMN reduc oxidoreductase; HET: FMN; 2.10A {Gluconacetobacter hansenii} PDB: 3s2y_A* 4h6p_A* Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>1f4p_A Flavodoxin; electron transport, flavoprotein, FMN, 3D-STRCTURE, anisotropic refinement, redox protein; HET: FMN; 1.30A {Desulfovibrio vulgaris} SCOP: c.23.5.1 PDB: 1bu5_A* 1c7f_A* 1c7e_A* 1akr_A* 1fx1_A* 1akt_A* 1akq_A* 1aku_A* 1akv_A* 1azl_A* 1j8q_A* 2fx2_A* 3fx2_A* 4fx2_A* 5fx2_A* 1akw_A* 1i1o_A* 1wsw_A* 1wsb_A* 1xyv_A* ... Back     alignment and structure
>3svl_A Protein YIEF; E. coli CHRR enzyme, chromate bioremediation, tetramer role, mutant enzymes, oxidoreductase; HET: FMN; 2.20A {Escherichia coli} Back     alignment and structure
>3u7r_A NADPH-dependent FMN reductase; alpha/beta twisted open-sheet, lavoprotein, quinone reductas oxidoreductase; HET: MSE FNR 2PE; 1.40A {Paracoccus denitrificans} Back     alignment and structure
>3gfs_A FMN-dependent NADPH-azoreductase; flavoproteins, quinone reductase, flavodoxin, oligomerization, flavoprotein, oxidoreductase; HET: FMN; 2.10A {Bacillus subtilis} SCOP: c.23.5.4 PDB: 1nni_1* 2gsw_A* 3gfr_A* 3gfq_A* Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>3s2y_A Chromate reductase; uranium reductase, oxidoreductase; HET: FMN PG4; 2.24A {Gluconacetobacter hansenii} Back     alignment and structure
>2hpv_A FMN-dependent NADH-azoreductase; structural genomics, PS protein structure initiative, southeast collaboratory for S genomics, secsg; HET: FMN; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1t0i_A YLR011WP; FMN binding protein, flavodoxin, azoreductase, oxidoreductase; HET: FMN; 2.00A {Saccharomyces cerevisiae} SCOP: c.23.5.4 Back     alignment and structure
>1t5b_A Acyl carrier protein phosphodiesterase; structural genomics, FMN, alpha/beta/alpha sandwich, PSI, protein structure initiative; HET: FMN; 1.40A {Salmonella typhimurium} SCOP: c.23.5.3 PDB: 1tik_A 2z98_A* 2d5i_A* 1v4b_A* 2z9b_A* 2z9c_A* 2z9d_A* Back     alignment and structure
>1czn_A Flavodoxin; FMN binding, redox potential, electron transport; HET: FMN; 1.70A {Synechococcus elongatus} SCOP: c.23.5.1 PDB: 1czl_A* 1czu_A* 1d04_A* 1ofv_A* 1czr_A* 1czk_A* 1czo_A* 1czh_A* 1d03_A* Back     alignment and structure
>2amj_A Modulator of drug activity B; oxidoreductase, menadione, DT-diaphorase, montreal-kingston structural genomics initiative, BSGI; 1.80A {Escherichia coli} PDB: 2b3d_A* Back     alignment and structure
>1obo_A Flavodoxin; electron transfer, flavoprotein, electron transport; HET: FMN; 1.2A {Anabaena SP} SCOP: c.23.5.1 PDB: 2v5v_A* 1dx9_A 1rcf_A* 1flv_A* 1obv_A* 2v5u_A* 1ftg_A 1qhe_A 2kqu_A 3esy_A* 3esz_A* 3esx_A* Back     alignment and structure
>3lcm_A SMU.1420, putative oxidoreductase; NADPH:quinone oxidoreductase, MDAB; HET: FAD NAP; 1.80A {Streptococcus mutans} PDB: 4f8y_A* Back     alignment and structure
>1ykg_A SIR-FP, sulfite reductase [NADPH] flavoprotein alpha- component; electron transport; HET: FMN; NMR {Escherichia coli} SCOP: c.23.5.2 Back     alignment and structure
>1yob_A Flavodoxin 2, flavodoxin II; alpha-beta fold, non- covalently bound FMN, electron transport; HET: FMN; 2.25A {Azotobacter vinelandii} SCOP: c.23.5.1 Back     alignment and structure
>3r6w_A FMN-dependent NADH-azoreductase 1; nitrofurazone, P. aeruginosa, nitroreductase, flavodoxin, oxidoreductase; HET: FMN NFZ; 2.08A {Pseudomonas aeruginosa} PDB: 3lt5_A* 2v9c_A* 3keg_A* Back     alignment and structure
>1d4a_A DT-diaphorase, quinone reductase; flavoprotein, rossman fold, oxidoreductase; HET: FAD; 1.70A {Homo sapiens} SCOP: c.23.5.3 PDB: 1dxo_A* 1gg5_A* 1kbo_A* 1kbq_A* 2f1o_A* 3jsx_A* 1h69_A* 1h66_A* 1qbg_A* 1dxq_A* 1qrd_A* Back     alignment and structure
>2fcr_A Flavodoxin; electron transport; HET: FMN; 1.80A {Chondrus crispus} SCOP: c.23.5.1 Back     alignment and structure
>1ag9_A Flavodoxin; electron transport, reductive activation; HET: FMN BTB; 1.80A {Escherichia coli} SCOP: c.23.5.1 PDB: 1ahn_A* Back     alignment and structure
>3p0r_A Azoreductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>2wc1_A Flavodoxin; electron transport, flavoprotein; HET: FMN; 2.17A {Rhodobacter capsulatus} Back     alignment and structure
>2hna_A Protein MIOC, flavodoxin; alpha-beta sandwich, flavodoxin fold, electron transport; NMR {Escherichia coli} PDB: 2hnb_A Back     alignment and structure
>3tem_A Ribosyldihydronicotinamide dehydrogenase [quinone; oxidoreductase-oxidoreductase inhibitor complex; HET: FAD 6A1 IMD; 1.45A {Homo sapiens} SCOP: c.23.5.3 PDB: 3te7_A* 3tzb_A* 3fw1_A* 2qwx_A* 1zx1_A* 3g5m_A* 3gam_A* 3ovm_A* 3owh_A* 3owx_A* 3ox1_A* 3ox2_A* 3ox3_A* 1sg0_A* 1qr2_A* 1xi2_A* 2qmy_A* 2qmz_A* 2qr2_A* 2qx4_A* ... Back     alignment and structure
>3f2v_A General stress protein 14; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: FMN; 2.00A {Treponema denticola} Back     alignment and structure
>3u7i_A FMN-dependent NADH-azoreductase 1; structural genomics, the center for structural genomics of I diseases, csgid, oxidoreductase; HET: MSE; 1.75A {Bacillus anthracis} Back     alignment and structure
>3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3rpe_A MDAB, modulator of drug activity B; structural genomics, center for structural genomics of infec diseases, csgid, flavodoxin-like fold; HET: FAD; 1.10A {Yersinia pestis} Back     alignment and structure
>1bvy_F Protein (cytochrome P450 BM-3); fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase; HET: HEM FMN; 2.03A {Bacillus megaterium} SCOP: c.23.5.1 Back     alignment and structure
>2bmv_A Flavodoxin; electron transport, flavoprotein, FMN, transport protein; 2.11A {Helicobacter pylori} PDB: 2w5u_A* 1fue_A* Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>4ici_A Putative flavoprotein; PF12682 family protein, flavodoxin_4, structural genomics, J center for structural genomics, JCSG; HET: MSE FMN EPE; 1.40A {Bacteroides eggerthii} Back     alignment and structure
>4gi5_A Quinone reductase; protein structure initiative, FAD bound, structural genomics, PSI-biology; HET: FAD; 1.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ha2_A NADPH-quinone reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics, consortium, NESG; HET: MSE; 1.80A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, CALM binding, FAD, FMN, heme, iron, metal-binding, NADP, oxidore phosphoprotein; HET: FMN; 2.50A {Homo sapiens} Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>2xod_A NRDI protein, NRDI; flavoprotein, redox protein, ribonucleotide reductase; HET: FMN; 0.96A {Bacillus anthracis} PDB: 2xoe_A* 2x2o_A* 2x2p_A* Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure
>3n3a_C Protein NRDI; ribonucleotide reductase, four-helix bundle, dimanganese CLU flavoprotein, oxidoreductase; HET: FMN; 1.99A {Escherichia coli} PDB: 3n39_C* 3n3b_C* Back     alignment and structure
>1rlj_A NRDI protein; flavoprotein, FMN, thioredoxin, alpha/beta/alpha sandwich, structural genomics, PSI, protein structure initiative; HET: FMN; 2.00A {Bacillus subtilis} SCOP: c.23.5.7 Back     alignment and structure
>2m1z_A LMO0427 protein; homolog PTS system IIB component, transferase; NMR {Listeria monocytogenes egd-e} Back     alignment and structure
>2kyr_A Fructose-like phosphotransferase enzyme IIB compo; ALP protein, structural genomics, PSI-2; NMR {Escherichia coli} Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 192
d1ydga_201 c.23.5.8 (A:) Trp repressor binding protein WrbA { 2e-49
d2a5la1196 c.23.5.8 (A:3-198) Trp repressor binding protein W 3e-47
d2arka1184 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolic 2e-32
d1sqsa_232 c.23.5.5 (A:) Hypothetical protein SP1951 {(Strept 3e-17
d1e5da1152 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreduct 7e-16
d1rlia_179 c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus 4e-15
d1ycga1149 c.23.5.1 (A:251-399) Nitric oxide reductase C-term 9e-12
d1vmea1148 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, 3e-09
d5nula_138 c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii 6e-07
d1t0ia_185 c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker 1e-04
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Length = 201 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: WrbA-like
domain: Trp repressor binding protein WrbA
species: Deinococcus radiodurans [TaxId: 1299]

 Score =  157 bits (397), Expect = 2e-49
 Identities = 63/197 (31%), Positives = 88/197 (44%), Gaps = 13/197 (6%)

Query: 1   MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLG-----KMSAPPKSDVPIITPN 55
             G    +A+E  +   +  G E +L +V ET P++V+      K +     DVP  TP 
Sbjct: 12  STGTGYAMAQEAAEAGRA-AGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPA 70

Query: 56  ELAEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETT 115
           +L  A+  VF  PTRFG   +Q +AF+D  GGLW + +LA K      S  +  GGQETT
Sbjct: 71  DLEWAEAIVFSSPTRFGGATSQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETT 130

Query: 116 ALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGAGTFAGDGSRQPTELELEQAF 175
             T     +H G +  P GYT            GG+PYGA   A    +   E +     
Sbjct: 131 LQTLYMTAMHWGAVLTPPGYTDEVIF-----KSGGNPYGASVTANG--QPLLENDRASIR 183

Query: 176 HQGKHIAGIAKKLKGSA 192
           HQ +    +  KL    
Sbjct: 184 HQVRRQVELTAKLLEGG 200
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Length = 196 Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Length = 184 Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Length = 232 Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Length = 152 Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Length = 149 Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 148 Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Length = 138 Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 185 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 100.0
d2a5la1196 Trp repressor binding protein WrbA {Pseudomonas ae 100.0
d2arka1184 Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} 99.98
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 99.95
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 99.95
d1rlia_179 Hypothetical protein YwqN {Bacillus subtilis [TaxI 99.88
d5nula_138 Flavodoxin {Clostridium beijerinckii [TaxId: 1520] 99.87
d1sqsa_232 Hypothetical protein SP1951 {(Streptococcus pneumo 99.87
d2fzva1233 Putative arsenical resistance protein {Shigella fl 99.87
d2fz5a1137 Flavodoxin {Megasphaera elsdenii [TaxId: 907]} 99.86
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 99.86
d1nni1_171 Azobenzene reductase {Bacillus subtilis [TaxId: 14 99.85
d1rtta_174 Hypothetical protein PA1204 {Pseudomonas aeruginos 99.83
d1t0ia_185 Hypothetical protein Ylr011wp {Baker's yeast (Sacc 99.79
d2z98a1200 ACP phosphodiesterase AcpD {Escherichia coli [TaxI 99.71
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 99.67
d2qwxa1230 Quinone reductase type 2 (menadione reductase) {Hu 99.64
d1d4aa_273 NAD(P)H:quinone reductase {Human (Homo sapiens) [T 99.63
d1czna_169 Flavodoxin {Synechococcus elongatus PCC 7942 [TaxI 99.59
d1oboa_169 Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 11 99.54
d1ag9a_175 Flavodoxin {Escherichia coli [TaxId: 562]} 99.46
d2fcra_173 Flavodoxin {Chondrus crispus [TaxId: 2769]} 99.43
d1yoba1179 Flavodoxin {Azotobacter vinelandii [TaxId: 354]} 99.43
d1ykga1146 Sulfite reductase alpha-component CysJ N-terminal 99.34
d1fuea_163 Flavodoxin {Helicobacter pylori [TaxId: 210]} 99.2
d1bvyf_152 FMN-binding domain of the cytochrome P450bm-3 {Bac 98.97
d1ja1a2177 NADPH-cytochrome p450 reductase, N-terminal domain 98.93
d1tlla2202 Nitric oxide (NO) synthase FMN domain {Rat (Rattus 98.66
d1rlja_135 Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423] 97.84
d2r48a1103 Mannose-specific enzyme IIBCA component ManP, N-te 86.42
d2r4qa1103 Fructose-specific enzyme IIABC component FruA, mid 85.36
d1gg4a1135 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 82.67
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 80.07
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: WrbA-like
domain: Trp repressor binding protein WrbA
species: Deinococcus radiodurans [TaxId: 1299]

Probab=100.00  E-value=2.6e-35  Score=222.45  Aligned_cols=182  Identities=35%  Similarity=0.509  Sum_probs=152.4

Q ss_pred             CCCHHHHHHHHHHHhccccCCceeEEEEcCCCCCHHHhcccCC-----CCCCCCCCCChhHhhhCCEEEEeccccCCCch
Q 029532            1 MYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLPEEVLGKMSA-----PPKSDVPIITPNELAEADGFVFGFPTRFGMMA   75 (192)
Q Consensus         1 ~~GnT~~la~~i~~~l~~~~g~ev~~~~l~~~~~~~~~~~~~~-----~~~~~~~~~~~~~l~~aD~ii~gsP~y~g~~~   75 (192)
                      ++|||++||++|++++++ .|+|++++++.+..++.++.++.+     |..+|.+....++|.+||+||||||+||++++
T Consensus        12 ~~GnT~~la~~ia~g~~~-~G~ev~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~i~~aD~ii~gsPvy~~~~s   90 (201)
T d1ydga_          12 STGTGYAMAQEAAEAGRA-AGAEVRLLKVRETAPQDVIDGQDAWKANIEAMKDVPEATPADLEWAEAIVFSSPTRFGGAT   90 (201)
T ss_dssp             SSSHHHHHHHHHHHHHHH-TTCEEEEEECCCCSCHHHHTTCHHHHHHHHHTTTSCBCCHHHHHHCSEEEEEEEEETTEEC
T ss_pred             CCcHHHHHHHHHHHHHHh-cCCEEEEEEccccCccchhhhhhHhhcCCCcccCchhhhhhhHhhCCEeEEecceeeeecc
Confidence            589999999999999999 699999999999877665544322     23455555568999999999999999999999


Q ss_pred             HHHHHHHHhhccccccCCCCCCcEEEEEecCCCCCChHHHHHHHHHHHHHcCCEEecCCccCCCCccccccccCCCCCcc
Q 029532           76 AQFKAFLDATGGLWRTQQLAGKPAGMFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTFGAGMFEMEKVKGGSPYGA  155 (192)
Q Consensus        76 ~~~k~fld~~~~~~~~~~l~gK~~~~~~s~g~~~g~~~~~l~~~~~~l~~~g~~vv~~~~~~~~~~~~~~~~~~~~~~g~  155 (192)
                      ++||.||||+..+|....+.||+++.|+++|+.+++++.++..+...+..+||.+++.++....     ....++++||.
T Consensus        91 ~~~k~flDr~~~~~~~~~l~gK~~~~~~s~g~~~gg~e~~~~~~~~~~~~~g~~~v~~~~~~~~-----~~~~gg~~~G~  165 (201)
T d1ydga_          91 SQMRAFIDTLGGLWSSGKLANKTFSAMTSAQNVNGGQETTLQTLYMTAMHWGAVLTPPGYTDEV-----IFKSGGNPYGA  165 (201)
T ss_dssp             HHHHHHHHTTHHHHHTTTTTTCEEEEEEEESSTTSSTTHHHHHHHHHHHTTTCEECCCTTCSHH-----HHHTTCCSSSC
T ss_pred             chhHHHHHHhhhHHhccccCCceeeeeeccccCCCchHHHHHhHHHHHHHcCCccccccccchh-----hhcCCCcccCc
Confidence            9999999999877766789999999999999998888889999999999999999987654211     11356778998


Q ss_pred             ceecCCCCCCCCHHHHHHHHHHHHHHHHHHHHhhc
Q 029532          156 GTFAGDGSRQPTELELEQAFHQGKHIAGIAKKLKG  190 (192)
Q Consensus       156 ~~~~~~~~~~p~~~~~~~~~~lg~~la~~~~~~~~  190 (192)
                      .+.+.  ...|++++++.|++||++||+.+++|+.
T Consensus       166 ~~~~~--~~~~~e~~l~~ar~lGk~la~~a~kL~~  198 (201)
T d1ydga_         166 SVTAN--GQPLLENDRASIRHQVRRQVELTAKLLE  198 (201)
T ss_dssp             EEECC--SSCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ceecC--CCCCCHHHHHHHHHHHHHHHHHHHHHHh
Confidence            77764  3358999999999999999999999864
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Back     information, alignment and structure
>d2fzva1 c.23.5.4 (A:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2z98a1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4aa_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czna_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]} Back     information, alignment and structure
>d1oboa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} Back     information, alignment and structure
>d1ag9a_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rlja_ c.23.5.7 (A:) Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r48a1 c.44.2.2 (A:2-104) Mannose-specific enzyme IIBCA component ManP, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r4qa1 c.44.2.2 (A:171-273) Fructose-specific enzyme IIABC component FruA, middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gg4a1 c.59.1.1 (A:313-447) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure