Citrus Sinensis ID: 029546

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MGTGGSEEYLNFDLKDPPFQVYRTERGGEVTYHGPGQLVMYPIINLRNHKMDLHWYLRALEEVAIRVLSTFSIKASRVEGLTGVWVGDQKLAAIGIRVSQWIAYHGLALNVTTDLTPFRWIVPCGIQNRHVGSIKGLLGESQSLTAEFRHPDDCKLIDIAHNSLIKEFSEVFQLEIHNKAIPLSEHLEKNI
ccccccccccccccccccccEEEccccccccECccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHccccEECcccccEEEEcccEEEEEEEEEEcccccccccccccccccccccccccccccccEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEECccccccHHHcccc
*G*GGSEEYLNFDLKDPPFQVYRTERGGEVTYHGPGQLVMYPIINLRNHKMDLHWYLRALEEVAIRVLSTFSIKASRVEGLTGVWVGDQKLAAIGIRVSQWIAYHGLALNVTTDLTPFRWIVPCGIQNRHVGSIKGLLGESQSLTAEFRHPDDCKLIDIAHNSLIKEFSEVFQLEIHNKAI**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTGGSEEYLNFDLKDPPFQVYRTERGGEVTYHGPGQLVMYPIINLRNHKMDLHWYLRALEEVAIRVLSTFSIKASRVEGLTGVWVGDQKLAAIGIRVSQWIAYHGLALNVTTDLTPFRWIVPCGIQNRHVGSIKGLLGESQSLTAEFRHPDDCKLIDIAHNSLIKEFSEVFQLEIHNKAIPLSEHLEKNI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Plastidial lipoyltransferase 2 Catalyzes the transfer of the endogenously synthesized lipoate to apoproteins, creating an amide linkage that joins the free carboxyl group of lipoic acid to the epsilon-amino group of a specific lysine residue in lipoate-dependent enzymes. Utilizes lipoyl-acyl-carrier-protein as a source of lipoyl groups, although octanoyl groups from octanoyl-ACP can also be transferred to the lipoyl domain of apoproteins.probableQ948J9
Octanoyltransferase Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.probableQ31KN6
Octanoyltransferase Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.probableQ5N180

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.181Lipoyl(octanoyl) transferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QHS, chain A
Confidence level:very confident
Coverage over the Query: 1-177
View the alignment between query and template
View the model in PyMOL