Citrus Sinensis ID: 029549


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MASSGEEWSPDTLAFMDLAIQQAKLALDSLEVPVGCVILEDGKVIAAGRNRTTETRNATRHAEMEAIDVLLDQWQKNGLSQSEIAEKFSKCCLYVTCEPCIMCAAALSILGIKEVYYGCANEKFGGCGSILSLHLSDSKMLNSGDVLGRKGFKCTGGVMASEAVSLFRSFYEQGNPNAPKPHRPLVHQAMN
cccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccEEEEECcccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEcccEEEEEccccHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHcccccccccccHHHccc
***********TLAFMDLAIQQAKLALDSLEVPVGCVILEDGKVIAAGRNRTTETRNATRHAEMEAIDVLLDQWQKNGLSQSEIAEKFSKCCLYVTCEPCIMCAAALSILGIKEVYYGCANEKFGGCGSILSLHLSDSKMLNSGDVLGRKGFKCTGGVMASEAVSLFRSFY********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSGEEWSPDTLAFMDLAIQQAKLALDSLEVPVGCVILEDGKVIAAGRNRTTETRNATRHAEMEAIDVLLDQWQKNGLSQSEIAEKFSKCCLYVTCEPCIMCAAALSILGIKEVYYGCANEKFGGCGSILSLHLSDSKMLNSGDVLGRKGFKCTGGVMASEAVSLFRSFYEQGNPNAPKPHRPLVHQAMN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA-specific adenosine deaminase 2 Probably participates in deamination of adenosine-34 to inosine in many tRNAs.probableQ5E9J7
tRNA-specific adenosine deaminase 2 Probably participates in deamination of adenosine-34 to inosine in many tRNAs.probableQ0P4H0
tRNA-specific adenosine deaminase 2 Probably participates in deamination of adenosine-34 to inosine in many tRNAs.probableQ7Z6V5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DH1, chain A
Confidence level:very confident
Coverage over the Query: 10-173
View the alignment between query and template
View the model in PyMOL