Citrus Sinensis ID: 029565

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-

MARSWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVKDEL

ccccHHHHHHHHHHHHHHHHcccccccccccccCEEEccccccccccccccEEEEEEccccccccEEEEEEEEEccccccccccccccEEEEEEEcEEEEEEcccccccccccccEEEEccccEEECcccccEEEECccccccEEEEEEEcccccCEEccccccccccccccccccccccccccccccccc

***SWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCL********

xxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MARSWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVKDEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Auxin-binding protein T92	This is probably a receptor for the plant hormone auxin.	probable	P33491
Auxin-binding protein 1	This is probably a receptor for the plant hormone auxin.	probable	P33487
Auxin-binding protein T85	This is probably a receptor for the plant hormone auxin.	probable	P33490

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LR5, chain A
Confidence level:very confident
Coverage over the Query: 30-188
View the alignment between query and template
View the model in PyMOL