Citrus Sinensis ID: 029565

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MARSWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVKDEL
ccccHHHHHHHHHHHHHHHHcccccccccccccEEEEccccccccccccccEEEEEEccccccccEEEEEEEEEccccccccccccccEEEEEEEcEEEEEEcccccccccccccEEEEccccEEEEcccccEEEEEccccccEEEEEEEcccccEEEccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEHHHcccEccccccEEEEEEEcHHHHccccEEEEEEEEccccEccEEEEcccEEEEEEEccEEEEEEcccccccccccEEEEEcccEEEEccccccEEEEcccccccEEEEEEEEcccccEEEEccccccHHHcEEEcccHHHHHHHHHcccccc
MARSWLIFLCLSFILLSANieadashcsikgfplvrniselpqdnygregLAHITVAGSILHGMKEIEVWLqtfspgtrtpihrhsCEEIFIVLKGSGtlylassshekhpgkpqehfffanstfhipvndahqvwntnenedLQMLVVisrppvkvfiyedwsmphtaaklkfpyfwdeqclqspvkdel
MARSWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVKDEL
MARSWliflclsfillsANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVKDEL
***SWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLA*************HFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCL********
***SWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQC*********
MARSWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYL**********KPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCL********
*ARSWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVKDEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
P33491187 Auxin-binding protein T92 N/A no 0.973 0.994 0.729 2e-78
P33490187 Auxin-binding protein T85 N/A no 0.890 0.909 0.783 4e-78
P33487198 Auxin-binding protein 1 O yes no 0.963 0.929 0.661 2e-71
P33488204 Auxin-binding protein 4 O N/A no 0.816 0.764 0.746 2e-66
P13689201 Auxin-binding protein 1 O N/A no 0.921 0.875 0.646 7e-65
P33489150 Auxin-binding protein 5 ( N/A no 0.534 0.68 0.708 7e-38
>sp|P33491|ABP2_TOBAC Auxin-binding protein T92 OS=Nicotiana tabacum GN=T92 PE=3 SV=1 Back     alignment and function desciption
 Score =  291 bits (745), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 140/192 (72%), Positives = 157/192 (81%), Gaps = 6/192 (3%)

Query: 1   MARSWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSI 60
           MAR  +I + + +        A+ASHCSI G PLVRNISELPQ+NYGR GL+H T+AGS+
Sbjct: 1   MARHIIILVAVFWFAT-----AEASHCSINGLPLVRNISELPQENYGRSGLSHTTIAGSV 55

Query: 61  LHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFF 120
           LHGMKEIEVWLQTF+PG RTPIHRHSCEEIFIVLKG GTLYL  SSH K+PG PQE   F
Sbjct: 56  LHGMKEIEVWLQTFAPGFRTPIHRHSCEEIFIVLKGQGTLYLTPSSHSKYPGNPQEFHIF 115

Query: 121 ANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDE 180
            NSTFHIPVND HQVWNT E EDLQ+L VISRPPVKVF+Y+DWSMPHTAAKLKFPY+WDE
Sbjct: 116 PNSTFHIPVNDVHQVWNTGEQEDLQVLDVISRPPVKVFMYDDWSMPHTAAKLKFPYYWDE 175

Query: 181 QCLQSPV-KDEL 191
           +C Q+   KDEL
Sbjct: 176 ECYQTTSRKDEL 187
This is probably a receptor for the plant hormone auxin.
Nicotiana tabacum (taxid: 4097)
>sp|P33490|ABP1_TOBAC Auxin-binding protein T85 OS=Nicotiana tabacum GN=T85 PE=3 SV=1 Back     alignment and function description
>sp|P33487|ABP1_ARATH Auxin-binding protein 1 OS=Arabidopsis thaliana GN=ERABP1 PE=1 SV=1 Back     alignment and function description
>sp|P33488|ABP4_MAIZE Auxin-binding protein 4 OS=Zea mays GN=ABP4 PE=2 SV=1 Back     alignment and function description
>sp|P13689|ABP1_MAIZE Auxin-binding protein 1 OS=Zea mays GN=ABP1 PE=1 SV=1 Back     alignment and function description
>sp|P33489|ABP5_MAIZE Auxin-binding protein 5 (Fragment) OS=Zea mays GN=ABP5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
190344258193 auxin-binding protein 1 [Populus tomento 1.0 0.989 0.790 9e-86
56236456194 auxin-binding protein 1 [Populus tomento 0.879 0.865 0.863 2e-84
262064796188 auxin-binding protein 1 [Dimocarpus long 0.984 1.0 0.785 2e-84
225436882188 PREDICTED: auxin-binding protein T85 [Vi 0.890 0.904 0.841 7e-84
224117158194 auxin binding protein [Populus trichocar 0.879 0.865 0.863 7e-84
196885937188 auxin-binding protein 1 [Vitis vinifera] 0.890 0.904 0.835 4e-83
158633397189 putative auxin-binding protein 1 [Boehme 0.890 0.899 0.841 4e-83
255567638192 Auxin-binding protein T85 precursor, put 0.994 0.989 0.777 7e-82
122831045190 auxin-binding protein 1 [Gossypium hirsu 0.879 0.884 0.828 8e-82
356500228191 PREDICTED: auxin-binding protein 1-like 0.963 0.963 0.761 4e-81
>gi|190344258|gb|AAX94549.2| auxin-binding protein 1 [Populus tomentosa] Back     alignment and taxonomy information
 Score =  321 bits (822), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 169/191 (88%)

Query: 1   MARSWLIFLCLSFILLSANIEADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSI 60
           M+   ++  C+  +LL   I   +S CSIKG PLVRNISELPQDNYGR GL+HIT+AGS 
Sbjct: 3   MSGVLVLIFCILSLLLPLLITTASSWCSIKGLPLVRNISELPQDNYGRGGLSHITLAGSA 62

Query: 61  LHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFF 120
           +HG+KE+EVWLQTFSPG+RTPIHRHSCEEIF+VLKGSGTLYLASSSHEK+PGKPQE+F F
Sbjct: 63  MHGLKEVEVWLQTFSPGSRTPIHRHSCEEIFVVLKGSGTLYLASSSHEKYPGKPQEYFVF 122

Query: 121 ANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDE 180
           ANSTFHIPVND HQVWNTNE+EDLQMLVVISRPPVKVFIYEDW MPHTAAKLKFPY+WDE
Sbjct: 123 ANSTFHIPVNDVHQVWNTNEHEDLQMLVVISRPPVKVFIYEDWFMPHTAAKLKFPYYWDE 182

Query: 181 QCLQSPVKDEL 191
           QCL  P+KDEL
Sbjct: 183 QCLLEPLKDEL 193

Source: Populus tomentosa

Species: Populus tomentosa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|56236456|gb|AAV84584.1| auxin-binding protein 1 [Populus tomentosa] Back     alignment and taxonomy information
>gi|262064796|gb|ACX54195.3| auxin-binding protein 1 [Dimocarpus longan] Back     alignment and taxonomy information
>gi|225436882|ref|XP_002273447.1| PREDICTED: auxin-binding protein T85 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224117158|ref|XP_002331762.1| auxin binding protein [Populus trichocarpa] gi|222874355|gb|EEF11486.1| auxin binding protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|196885937|gb|ACG80594.1| auxin-binding protein 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|158633397|gb|ABW75767.1| putative auxin-binding protein 1 [Boehmeria nivea] Back     alignment and taxonomy information
>gi|255567638|ref|XP_002524798.1| Auxin-binding protein T85 precursor, putative [Ricinus communis] gi|223535982|gb|EEF37641.1| Auxin-binding protein T85 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|122831045|gb|ABM66812.1| auxin-binding protein 1 [Gossypium hirsutum] gi|222840504|gb|ACM68695.1| auxin-binding protein 1 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|356500228|ref|XP_003518935.1| PREDICTED: auxin-binding protein 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
UNIPROTKB|P33491187 T92 "Auxin-binding protein T92 0.890 0.909 0.795 5.7e-75
UNIPROTKB|P33490187 T85 "Auxin-binding protein T85 0.890 0.909 0.783 1.5e-74
TAIR|locus:2005491198 ABP1 "endoplasmic reticulum au 0.853 0.823 0.739 4.4e-68
UNIPROTKB|P33488204 ABP4 "Auxin-binding protein 4" 0.816 0.764 0.746 2.6e-63
UNIPROTKB|P13689201 ABP1 "Auxin-binding protein 1" 0.858 0.815 0.676 1.2e-60
UNIPROTKB|P33489150 ABP5 "Auxin-binding protein 5" 0.534 0.68 0.708 2.1e-36
UNIPROTKB|P33491 T92 "Auxin-binding protein T92" [Nicotiana tabacum (taxid:4097)] Back     alignment and assigned GO terms
 Score = 756 (271.2 bits), Expect = 5.7e-75, P = 5.7e-75
 Identities = 136/171 (79%), Positives = 149/171 (87%)

Query:    22 ADASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTP 81
             A+ASHCSI G PLVRNISELPQ+NYGR GL+H T+AGS+LHGMKEIEVWLQTF+PG RTP
Sbjct:    17 AEASHCSINGLPLVRNISELPQENYGRSGLSHTTIAGSVLHGMKEIEVWLQTFAPGFRTP 76

Query:    82 IHRHSCEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNEN 141
             IHRHSCEEIFIVLKG GTLYL  SSH K+PG PQE   F NSTFHIPVND HQVWNT E 
Sbjct:    77 IHRHSCEEIFIVLKGQGTLYLTPSSHSKYPGNPQEFHIFPNSTFHIPVNDVHQVWNTGEQ 136

Query:   142 EDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPV-KDEL 191
             EDLQ+L VISRPPVKVF+Y+DWSMPHTAAKLKFPY+WDE+C Q+   KDEL
Sbjct:   137 EDLQVLDVISRPPVKVFMYDDWSMPHTAAKLKFPYYWDEECYQTTSRKDEL 187
GO:0008270 "zinc ion binding" evidence=ISS
GO:0010011 "auxin binding" evidence=ISS
UNIPROTKB|P33490 T85 "Auxin-binding protein T85" [Nicotiana tabacum (taxid:4097)] Back     alignment and assigned GO terms
TAIR|locus:2005491 ABP1 "endoplasmic reticulum auxin binding protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P33488 ABP4 "Auxin-binding protein 4" [Zea mays (taxid:4577)] Back     alignment and assigned GO terms
UNIPROTKB|P13689 ABP1 "Auxin-binding protein 1" [Zea mays (taxid:4577)] Back     alignment and assigned GO terms
UNIPROTKB|P33489 ABP5 "Auxin-binding protein 5" [Zea mays (taxid:4577)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P13689ABP1_MAIZENo assigned EC number0.64600.92140.8756N/Ano
P33491ABP2_TOBACNo assigned EC number0.72910.97380.9946N/Ano
P33487ABP1_ARATHNo assigned EC number0.66120.96330.9292yesno
P33490ABP1_TOBACNo assigned EC number0.78360.89000.9090N/Ano
P33488ABP4_MAIZENo assigned EC number0.74680.81670.7647N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
ABP1
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (179 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00019977001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (676 aa)
      • 0.480
GSVIVG00019976001
RecName- Full=Copper amine oxidase; EC=1.4.3.6; (647 aa)
      • 0.480
GSVIVG00019973001
RecName- Full=Copper amine oxidase; EC=1.4.3.6; (674 aa)
      • 0.480
GSVIVG00001079001
RecName- Full=Copper amine oxidase; EC=1.4.3.6; (727 aa)
      • 0.480

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
pfam02041164 pfam02041, Auxin_BP, Auxin binding protein 1e-111
pfam0788370 pfam07883, Cupin_2, Cupin domain 1e-09
COG1917131 COG1917, COG1917, Uncharacterized conserved protei 1e-07
COG0662127 COG0662, {ManC}, Mannose-6-phosphate isomerase [Ca 0.001
COG5553191 COG5553, COG5553, Predicted metal-dependent enzyme 0.002
COG2140209 COG2140, COG2140, Thermophilic glucose-6-phosphate 0.002
COG3837161 COG3837, COG3837, Uncharacterized conserved protei 0.003
>gnl|CDD|110987 pfam02041, Auxin_BP, Auxin binding protein Back     alignment and domain information 
 Score =  313 bits (804), Expect = e-111
 Identities = 134/165 (81%), Positives = 152/165 (92%), Gaps = 1/165 (0%)

Query: 27  CSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHS 86
           CSI G PLVRNISELPQDNYGREGL+H TVAGS+LHGMKE+EVWLQTF+PG+RTPIHRHS
Sbjct: 1   CSINGLPLVRNISELPQDNYGREGLSHTTVAGSLLHGMKEVEVWLQTFAPGSRTPIHRHS 60

Query: 87  CEEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQM 146
           CEE+F+VLKGSGTLYLASS H K+PGKPQE   FANSTFHIPVND HQVWNT E+EDLQ+
Sbjct: 61  CEEVFVVLKGSGTLYLASS-HGKYPGKPQEFPIFANSTFHIPVNDVHQVWNTGEHEDLQV 119

Query: 147 LVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVKDEL 191
           LV+ISRPPVK+F+Y+DWSMPHTAAKLKFPY+WDE+C Q+  +DEL
Sbjct: 120 LVIISRPPVKIFMYDDWSMPHTAAKLKFPYYWDEECFQAAKEDEL 164

Length = 164
>gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain Back     alignment and domain information
>gnl|CDD|224829 COG1917, COG1917, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>gnl|CDD|223734 COG0662, {ManC}, Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|227840 COG5553, COG5553, Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|225051 COG2140, COG2140, Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|226357 COG3837, COG3837, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
PF02041167 Auxin_BP: Auxin binding protein; InterPro: IPR0005 100.0
PRK13290125 ectC L-ectoine synthase; Reviewed 99.7
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 99.64
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 99.62
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 99.58
COG3837161 Uncharacterized conserved protein, contains double 99.55
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 99.52
PRK11171266 hypothetical protein; Provisional 99.49
COG1917131 Uncharacterized conserved protein, contains double 99.48
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 99.44
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 99.42
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 99.41
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.4
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 99.39
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.39
smart00835146 Cupin_1 Cupin. This family represents the conserve 99.37
PRK11171266 hypothetical protein; Provisional 99.35
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 99.32
PRK04190191 glucose-6-phosphate isomerase; Provisional 99.27
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 99.17
PLN00212 493 glutelin; Provisional 99.08
PF06339126 Ectoine_synth: Ectoine synthase; InterPro: IPR0104 99.02
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 98.99
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 98.82
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 98.78
PRK15457233 ethanolamine utilization protein EutQ; Provisional 98.74
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 98.74
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 98.66
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 98.62
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 98.61
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 98.59
COG3257264 GlxB Uncharacterized protein, possibly involved in 98.56
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 98.41
TIGR02272335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 98.39
COG3257264 GlxB Uncharacterized protein, possibly involved in 98.34
PRK10371 302 DNA-binding transcriptional regulator MelR; Provis 98.25
PRK13501 290 transcriptional activator RhaR; Provisional 98.25
COG3435351 Gentisate 1,2-dioxygenase [Secondary metabolites b 98.22
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 98.18
PRK10296 278 DNA-binding transcriptional regulator ChbR; Provis 98.16
PRK13500 312 transcriptional activator RhaR; Provisional 98.13
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 98.12
PLN00212493 glutelin; Provisional 98.12
PRK13502 282 transcriptional activator RhaR; Provisional 98.09
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 98.07
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 98.06
COG3435 351 Gentisate 1,2-dioxygenase [Secondary metabolites b 98.02
TIGR02297 287 HpaA 4-hydroxyphenylacetate catabolism regulatory 97.98
PRK13503 278 transcriptional activator RhaS; Provisional 97.97
PF06052151 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte 97.89
COG1791181 Uncharacterized conserved protein, contains double 97.86
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 97.75
COG4297163 Uncharacterized protein containing double-stranded 97.73
PF05995175 CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 97.72
PF14499 251 DUF4437: Domain of unknown function (DUF4437); PDB 97.59
KOG2107179 consensus Uncharacterized conserved protein, conta 97.16
PF07385225 DUF1498: Protein of unknown function (DUF1498); In 97.15
PRK10572 290 DNA-binding transcriptional regulator AraC; Provis 96.94
COG3450116 Predicted enzyme of the cupin superfamily [General 96.61
KOG3995 279 consensus 3-hydroxyanthranilate oxygenase HAAO [Am 96.59
COG3822225 ABC-type sugar transport system, auxiliary compone 96.55
PF14499251 DUF4437: Domain of unknown function (DUF4437); PDB 96.53
KOG2757411 consensus Mannose-6-phosphate isomerase [Carbohydr 96.32
PF04209 424 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR 95.93
PF05118163 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl 95.68
PF00908176 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer 95.65
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela 95.65
PF12852186 Cupin_6: Cupin 95.64
PF02678107 Pirin: Pirin; InterPro: IPR003829 This entry repre 95.57
PF07847200 DUF1637: Protein of unknown function (DUF1637); In 95.57
COG1741 276 Pirin-related protein [General function prediction 95.37
TIGR01221176 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en 95.37
PF05726104 Pirin_C: Pirin C-terminal cupin domain; InterPro: 94.99
COG3806216 ChrR Transcriptional activator [Transcription] 94.94
PF04962261 KduI: KduI/IolB family; InterPro: IPR021120 The Kd 94.61
PRK09685 302 DNA-binding transcriptional activator FeaR; Provis 94.37
PF0931382 DUF1971: Domain of unknown function (DUF1971); Int 94.18
COG5553191 Predicted metal-dependent enzyme of the double-str 94.06
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 93.99
PRK05341 438 homogentisate 1,2-dioxygenase; Provisional 93.97
PF04962 261 KduI: KduI/IolB family; InterPro: IPR021120 The Kd 93.96
PLN02288394 mannose-6-phosphate isomerase 93.88
PF14525172 AraC_binding_2: AraC-binding-like domain 93.8
PLN02658 435 homogentisate 1,2-dioxygenase 93.72
PF0686594 DUF1255: Protein of unknown function (DUF1255); In 93.65
PF1114263 DUF2917: Protein of unknown function (DUF2917); In 93.44
PRK00924 276 5-keto-4-deoxyuronate isomerase; Provisional 93.24
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 93.13
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 93.09
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 92.99
PRK15131389 mannose-6-phosphate isomerase; Provisional 92.81
PRK00924276 5-keto-4-deoxyuronate isomerase; Provisional 92.39
TIGR01015 429 hmgA homogentisate 1,2-dioxygenase. Missing in hum 91.97
COG3718 270 IolB Uncharacterized enzyme involved in inositol m 91.88
PRK1057994 hypothetical protein; Provisional 91.77
COG2850 383 Uncharacterized conserved protein [Function unknow 90.67
PF13759101 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB 89.99
COG1482312 ManA Phosphomannose isomerase [Carbohydrate transp 89.94
PHA00672152 hypothetical protein 88.94
TIGR02466201 conserved hypothetical protein. This family consis 88.25
PRK12335 287 tellurite resistance protein TehB; Provisional 86.51
COG3508 427 HmgA Homogentisate 1,2-dioxygenase [Secondary meta 85.87
PRK09391230 fixK transcriptional regulator FixK; Provisional 85.57
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 83.27
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 83.1
>PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) Back     alignment and domain information 
Probab=100.00  E-value=2.9e-43  Score=268.30  Aligned_cols=167  Identities=85%  Similarity=1.435  Sum_probs=114.7

Q ss_pred             cCcCcccCCCeeEecCCCCCCccCCCCcEEEEEEeeccCCceeEEEEEEEECCCCcCCceecCCcEEEEEEeCEEEEEEC
Q 029565           24 ASHCSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLA  103 (191)
Q Consensus        24 ~~~~~~~~~~~V~~i~d~~~~~~~~~G~~~~~~~~~~~~g~~~~~~~~~~i~PG~~~~~H~H~~eE~~~Vl~G~~~v~i~  103 (191)
                      +++|+++|.|+|+||+++++.+++++|...+++.+....|.+.+++++++|.||..+|.|+|..||+++||+|+|++.+.
T Consensus         1 a~~~~~~~~~~Vr~iselpq~~ygr~GLsH~TvAGa~~hGmkevEVwlQTfAPG~~TPiHRHsCEEVFvVLkG~GTl~l~   80 (167)
T PF02041_consen    1 ASQCSIRGLPLVRNISELPQDNYGRPGLSHITVAGALLHGMKEVEVWLQTFAPGSATPIHRHSCEEVFVVLKGSGTLYLA   80 (167)
T ss_dssp             ----------SEEEGGGS--B-TT-TTEEEEEEE-HHHH--SSEEEEEEEE-TT-B--EEEESS-EEEEEEE--EEEEE-
T ss_pred             CCcCCCCCCceeEEhhhCccccccCCCcceEEeehhhhcCceeeeEEeeeecCCCCCCCccccccEEEEEEecceEEEEe
Confidence            47899999999999999999999999999999998777899999999999999999999999999999999999999998


Q ss_pred             CeeeecCCCCCceeeecCCeEEEECCCCcEEEEeCCCCCcEEEEEEEeCCCceeeecCCCCCcccccccCccccccccCC
Q 029565          104 SSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCL  183 (191)
Q Consensus       104 ~~~~~l~~gk~~d~~l~~GD~v~ip~g~~H~~~N~g~~e~~~~l~v~~~p~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~  183 (191)
                      . .....+||++++.+.++++++||.|..|+++|.++.|++++++++++|++++++|+||+|+++||+++|||.||+||.
T Consensus        81 ~-~~~~~pG~pqef~~~pnSTf~IPvn~~HQv~NT~e~eDlqvlViiSrpPvkvf~y~dw~~phtaa~l~fp~~wd~~c~  159 (167)
T PF02041_consen   81 S-SHEKYPGKPQEFPIFPNSTFHIPVNDAHQVWNTNEHEDLQVLVIISRPPVKVFIYDDWSMPHTAAKLKFPYYWDEQCL  159 (167)
T ss_dssp             --SSSSS--S-EEEEE-TTEEEEE-TT--EEEE---SSS-EEEEEEEESSS--EEEESSTTS-GGG-EEESS-GGGHHHH
T ss_pred             c-ccccCCCCceEEEecCCCeEEeCCCCcceeecCCCCcceEEEEEecCCCeEEEEeccccCcchhhhhcCCccccHhHh
Confidence            4 445678999999999999999999999999999955799999999999999999999999999999999999999999


Q ss_pred             CCCCCCCC
Q 029565          184 QSPVKDEL  191 (191)
Q Consensus       184 ~~~~~~~~  191 (191)
                      |++.||||
T Consensus       160 ~~~~~del  167 (167)
T PF02041_consen  160 QAPKKDEL  167 (167)
T ss_dssp             HHT-----
T ss_pred             ccCCccCC
Confidence            99999997

The primary structure contains an N-terminal hydrophobic leader sequence of 30-40 amino acids, which could represent a signal for translocation of the protein to the ER [, ]. The mature protein comprises around 165 residues, and contains a number of potential N-glycosylation sites. In vitro transport studies have demonstrated co-translational glycosylation []. Retention within the lumen of the ER correlates with an additional signal located at the C terminus, represented by the sequence Lys-Asp-Glu-Leu, known to be responsible for preventing secretion of proteins from the lumen of the ER in eukaryotic cells [, ].; GO: 0004872 receptor activity, 0005788 endoplasmic reticulum lumen; PDB: 1LR5_D 1LRH_D.
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] Back     alignment and domain information
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] Back     alignment and domain information
>COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only] Back     alignment and domain information
>PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A Back     alignment and domain information
>KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism Back     alignment and domain information
>PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 Back     alignment and domain information
>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine Back     alignment and domain information
>COG1741 Pirin-related protein [General function prediction only] Back     alignment and domain information
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG3806 ChrR Transcriptional activator [Transcription] Back     alignment and domain information
>PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) Back     alignment and domain information
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional Back     alignment and domain information
>PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins Back     alignment and domain information
>COG5553 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only] Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>PRK05341 homogentisate 1,2-dioxygenase; Provisional Back     alignment and domain information
>PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) Back     alignment and domain information
>PLN02288 mannose-6-phosphate isomerase Back     alignment and domain information
>PF14525 AraC_binding_2: AraC-binding-like domain Back     alignment and domain information
>PLN02658 homogentisate 1,2-dioxygenase Back     alignment and domain information
>PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length Back     alignment and domain information
>PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria Back     alignment and domain information
>PRK00924 5-keto-4-deoxyuronate isomerase; Provisional Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PRK15131 mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PRK00924 5-keto-4-deoxyuronate isomerase; Provisional Back     alignment and domain information
>TIGR01015 hmgA homogentisate 1,2-dioxygenase Back     alignment and domain information
>COG3718 IolB Uncharacterized enzyme involved in inositol metabolism [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10579 hypothetical protein; Provisional Back     alignment and domain information
>COG2850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A Back     alignment and domain information
>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PHA00672 hypothetical protein Back     alignment and domain information
>TIGR02466 conserved hypothetical protein Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
1lr5_A163 Crystal Structure Of Auxin Binding Protein Length = 3e-63
>pdb|1LR5|A Chain A, Crystal Structure Of Auxin Binding Protein Length = 163 Back     alignment and structure 
Iteration: 1

 Score =  237 bits (604), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 109/163 (66%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
Query: 29  IKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCE 88
           ++   LVR+IS++PQ +YG EGL+HITVAG++ HGMKE+EVWLQT SPG RTPIHRHSCE
Sbjct: 3   VRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCE 62
Query: 89  EIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLV 148
           E+F VLKG GTL + SSS  K+PG+PQE  FF N+TF IPVND HQVWN++E+EDLQ+LV
Sbjct: 63  EVFTVLKGKGTLLMGSSSL-KYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLV 121
Query: 149 VISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVKDEL 191
           +ISRPP K+F+Y+DWSMPHTAA LKFP+ WDE C ++  K++L
Sbjct: 122 IISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEA-AKEQL 163

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 2e-70
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 1e-17
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 3e-16
1vj2_A126 Novel manganese-containing cupin TM1459; structura 1e-15
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 9e-15
1v70_A105 Probable antibiotics synthesis protein; structural 6e-14
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 4e-13
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 2e-12
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 3e-12
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 1e-11
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 2e-06
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 1e-11
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 3e-11
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 5e-11
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 3e-09
3h8u_A125 Uncharacterized conserved protein with double-STR 5e-09
2q30_A110 Uncharacterized protein; double-stranded beta-heli 5e-09
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 5e-08
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 1e-07
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 2e-07
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 4e-07
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 2e-05
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 4e-07
3rns_A227 Cupin 2 conserved barrel domain protein; structura 1e-06
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 1e-06
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 2e-06
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 2e-06
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 2e-06
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 2e-06
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 2e-06
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 4e-06
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 6e-06
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 4e-06
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 4e-06
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 1e-05
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 3e-05
3uss_A211 Putative uncharacterized protein; cupin, three his 7e-05
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 1e-04
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 1e-04
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 2e-04
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 2e-04
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 2e-04
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 3e-04
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 4e-04
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 3e-04
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 5e-04
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 6e-04
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 7e-04
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Length = 163 Back     alignment and structure
 Score =  210 bits (535), Expect = 2e-70
 Identities = 108/164 (65%), Positives = 137/164 (83%), Gaps = 2/164 (1%)

Query: 28  SIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSC 87
            ++   LVR+IS++PQ +YG EGL+HITVAG++ HGMKE+EVWLQT SPG RTPIHRHSC
Sbjct: 2   CVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSC 61

Query: 88  EEIFIVLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQML 147
           EE+F VLKG GTL + SSS + +PG+PQE  FF N+TF IPVND HQVWN++E+EDLQ+L
Sbjct: 62  EEVFTVLKGKGTLLMGSSSLK-YPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVL 120

Query: 148 VVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVKDEL 191
           V+ISRPP K+F+Y+DWSMPHTAA LKFP+ WDE C ++  K++L
Sbjct: 121 VIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAA-KEQL 163
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167 Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Length = 163 Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Length = 156 Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Length = 162 Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Length = 133 Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Length = 166 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Length = 115 Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Length = 125 Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Length = 110 Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Length = 171 Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Length = 126 Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Length = 114 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Length = 354 Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Length = 190 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Length = 227 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Length = 337 Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Length = 208 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Length = 114 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* Length = 368 Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Length = 117 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Length = 116 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} Length = 211 Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Length = 217 Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Length = 97 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Length = 278 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Length = 261 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 Back     alignment and structure
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Length = 200 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 99.94
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 99.69
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 99.67
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 99.67
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 99.65
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 99.63
1v70_A105 Probable antibiotics synthesis protein; structural 99.63
3h8u_A125 Uncharacterized conserved protein with double-STR 99.62
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 99.62
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 99.61
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 99.61
1sfn_A246 Conserved hypothetical protein; structural genomic 99.59
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 99.57
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 99.57
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 99.57
1vj2_A126 Novel manganese-containing cupin TM1459; structura 99.56
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 99.55
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 99.55
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 99.54
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 99.54
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 99.53
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 99.53
1sef_A274 Conserved hypothetical protein; structural genomic 99.52
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 99.52
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 99.52
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 99.52
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 99.51
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 99.51
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 99.51
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 99.5
2q30_A110 Uncharacterized protein; double-stranded beta-heli 99.49
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 99.49
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 99.48
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 99.48
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 99.47
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 99.47
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 99.47
4i4a_A128 Similar to unknown protein; structural genomics, P 99.46
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 99.45
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 99.45
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 99.44
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 99.43
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 99.42
3lwc_A119 Uncharacterized protein; structural genomics, unkn 99.42
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 99.42
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 99.42
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 99.41
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 99.41
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 99.4
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 99.4
1sef_A274 Conserved hypothetical protein; structural genomic 99.38
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 99.38
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 99.37
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 99.37
3rns_A227 Cupin 2 conserved barrel domain protein; structura 99.36
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 99.35
3rns_A227 Cupin 2 conserved barrel domain protein; structura 99.35
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 99.34
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 99.33
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 99.32
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 99.32
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 99.32
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 99.3
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 99.29
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 99.27
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 99.26
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 99.25
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 99.24
1sfn_A246 Conserved hypothetical protein; structural genomic 99.24
4axo_A151 EUTQ, ethanolamine utilization protein; structural 99.22
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 99.21
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 99.19
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 99.14
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 99.13
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 99.12
3d82_A102 Cupin 2, conserved barrel domain protein; structur 99.12
3cjx_A165 Protein of unknown function with A cupin-like FOL; 99.11
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 99.11
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 99.11
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 99.1
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 99.07
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 99.07
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 99.05
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 99.04
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 99.03
3bcw_A123 Uncharacterized protein; structural genomics, join 99.01
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 99.0
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 98.98
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 98.98
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 98.97
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 98.96
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 98.92
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 98.92
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 98.89
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 98.87
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 98.85
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 98.85
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 98.85
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 98.82
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 98.81
1uij_A416 Beta subunit of beta conglycinin; double-stranded 98.79
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 98.79
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 98.77
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 98.73
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 98.7
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 98.68
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 98.68
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 98.67
3bal_A153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 98.59
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 98.56
3fz3_A 531 Prunin; TREE NUT allergen, allergy, amandin, almon 98.56
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 98.53
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 98.47
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.44
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 98.44
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 98.43
3uss_A211 Putative uncharacterized protein; cupin, three his 98.23
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 98.2
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 98.16
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 98.08
3kmh_A246 D-lyxose isomerase; cupin beta-barrel, structural 98.07
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 97.98
3gbg_A 276 TCP pilus virulence regulatory protein; cupin, hel 97.9
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural geno 97.74
1dgw_X79 Canavalin; duplicated swiss-roll beta barrels, loo 97.57
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 97.51
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 97.45
3o14_A223 Anti-ecfsigma factor, CHRR; cupin, structural geno 97.3
1tq5_A242 Protein YHHW; bicupin, pirin, montreal-kingston ba 97.21
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell 97.2
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 97.03
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race 97.02
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l 96.99
1yud_A170 Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p 96.94
3ryk_A205 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 96.91
1dzr_A183 DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 96.89
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic 96.88
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 96.82
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 96.79
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesi 96.76
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 96.41
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 96.35
3rcq_A197 Aspartyl/asparaginyl beta-hydroxylase; structural 95.96
3bb6_A127 Uncharacterized protein YEAR; structural genomics, 95.95
4hn1_A201 Putative 3-epimerase in D-allose pathway; 3'-monoe 95.93
2qjv_A270 Uncharacterized IOLB-like protein; structural geno 95.54
1pmi_A440 PMI, phosphomannose isomerase; aldose-ketose isome 94.84
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 94.69
2p17_A 277 Pirin-like protein; GK1651, structural genomics, s 94.61
2qjv_A 270 Uncharacterized IOLB-like protein; structural geno 94.59
1e5r_A290 Proline oxidase; oxidoreductase, oxygenase, 2-oxog 94.45
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 94.15
2qdr_A 303 Uncharacterized protein; double-stranded beta-heli 93.97
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 93.96
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 93.9
2oyz_A94 UPF0345 protein VPA0057; unknown function, structu 93.84
1eyb_A 471 Homogentisate 1,2-dioxygenase; jelly roll, beta sa 93.8
3hqx_A111 UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC 93.53
1j1l_A 290 Pirin; beta sandwich, cupin, iron, metatl binding 93.38
3kv5_D488 JMJC domain-containing histone demethylation prote 93.08
2yu1_A 451 JMJC domain-containing histone demethylation PROT; 92.77
1tq5_A242 Protein YHHW; bicupin, pirin, montreal-kingston ba 92.73
1qwr_A319 Mannose-6-phosphate isomerase; structural genomics 92.46
4diq_A 489 Lysine-specific demethylase NO66; structural genom 92.45
2wfp_A394 Mannose-6-phosphate isomerase; APO-structure, meta 92.31
1ywk_A 289 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer 92.17
3dl3_A119 Tellurite resistance protein B; X-RAY NESG VFR98 Q 92.15
2p17_A277 Pirin-like protein; GK1651, structural genomics, s 92.04
1j1l_A290 Pirin; beta sandwich, cupin, iron, metatl binding 91.74
1qwr_A319 Mannose-6-phosphate isomerase; structural genomics 91.15
3k3o_A371 PHF8, PHD finger protein 8; histone demethylase, c 90.4
3eo6_A106 Protein of unknown function (DUF1255); AFE_2634, s 90.01
1zx5_A300 Mannosephosphate isomerase, putative; STRU genomic 89.48
2ypd_A392 Probable JMJC domain-containing histone demethyla 88.88
3pua_A392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 88.7
2rg4_A216 Uncharacterized protein; rhodobacterales, oceanico 88.01
2vec_A256 YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe 87.99
3esg_A193 HUTD, putative uncharacterized protein; beta barre 87.49
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 86.37
1xru_A282 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; 85.76
1xru_A 282 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; 85.28
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 83.54
1zx5_A300 Mannosephosphate isomerase, putative; STRU genomic 82.74
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 82.36
2qdr_A303 Uncharacterized protein; double-stranded beta-heli 81.71
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 81.43
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
Probab=99.94  E-value=2.3e-26  Score=178.66  Aligned_cols=159  Identities=68%  Similarity=1.218  Sum_probs=130.3

Q ss_pred             cCCCeeEecCCCCCCccCCCCcEEEEEEeeccCCceeEEEEEEEECCCCcCCceecCCcEEEEEEeCEEEEEECCeeeec
Q 029565           30 KGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSSHEK  109 (191)
Q Consensus        30 ~~~~~V~~i~d~~~~~~~~~G~~~~~~~~~~~~g~~~~~~~~~~i~PG~~~~~H~H~~eE~~~Vl~G~~~v~i~~~~~~l  109 (191)
                      +..++|+++++++...+..+|.....+......|...+.+...+++||...++|+|...|++||++|++++.+++.. ..
T Consensus         4 ~~~~~v~~~~~~~~~~~~~~G~~~~~l~~~~~~g~~~~~~~~~~~~pg~~~~~H~H~~~E~~~Vl~G~~~~~~~~~~-~~   82 (163)
T 1lr5_A            4 RDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSS-LK   82 (163)
T ss_dssp             CCCCSEEEGGGSCCBCTTCTTEEEEEEECHHHHCCSSEEEEEEEECTTCBCCEEEESSCEEEEEEECCEEEEECCSS-SS
T ss_pred             CCccEecChHHCChhhccCCCcceEEEeccccCCCCcEEEEEEEECCCCcCCCeECCCCeEEEEEeCEEEEEECCcc-cc
Confidence            45678999999999887667877666655433455579999999999999999999999999999999999999810 00


Q ss_pred             CCCCCceeeecCCeEEEECCCCcEEEEeCC-CCCcEEEEEEEeCCCceeeecCCCCCcccccccCccccccccCCCCCCC
Q 029565          110 HPGKPQEHFFFANSTFHIPVNDAHQVWNTN-ENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSPVK  188 (191)
Q Consensus       110 ~~gk~~d~~l~~GD~v~ip~g~~H~~~N~g-~~e~~~~l~v~~~p~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~  188 (191)
                      ..++.+.+.+.+||++++|+|++|+++|.+ + ++++++++..+++.+..++++|+++.+++++.+|+.|+++|+++ .|
T Consensus        83 ~~~~~~~~~l~~Gd~i~ip~~~~H~~~n~~~~-~~~~~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~  160 (163)
T 1lr5_A           83 YPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEH-EDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEA-AK  160 (163)
T ss_dssp             SCCSCEEEEECTTEEEEECTTCCEEEECCCSS-SCEEEEEEEESSSCCEEEESSTTSCGGGCEEESSCTTTHHHHHH-TC
T ss_pred             ccCccEEEEeCCCCEEEECCCCcEEeEeCCCC-CCEEEEEEECCCCcccccccccccCCcCccceeccccccccccc-hh
Confidence            001111268899999999999999999998 7 69999999998888888899999999999999999999999999 99


Q ss_pred             CCC
Q 029565          189 DEL  191 (191)
Q Consensus       189 ~~~  191 (191)
                      +||
T Consensus       161 ~~~  163 (163)
T 1lr5_A          161 EQL  163 (163)
T ss_dssp             ---
T ss_pred             hcC
Confidence            997
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} Back     alignment and structure
>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Back     alignment and structure
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 Back     alignment and structure
>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} Back     alignment and structure
>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Back     alignment and structure
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} Back     alignment and structure
>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 Back     alignment and structure
>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Back     alignment and structure
>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} Back     alignment and structure
>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 Back     alignment and structure
>1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A Back     alignment and structure
>3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 Back     alignment and structure
>1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Back     alignment and structure
>1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Back     alignment and structure
>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* Back     alignment and structure
>1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13 Back     alignment and structure
>3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 Back     alignment and structure
>2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} Back     alignment and structure
>1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Back     alignment and structure
>3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270} Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Back     alignment and structure
>2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A Back     alignment and structure
>2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} Back     alignment and structure
>3esg_A HUTD, putative uncharacterized protein; beta barrel, unknown function; 1.80A {Pseudomonas fluorescens} SCOP: b.82.1.0 Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A Back     alignment and structure
>1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1lr5a_160 b.82.1.2 (A:) Auxin binding protein {Maize (Zea ma 3e-57
d3elna1186 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {R 2e-17
d3bu7a1355 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si 2e-10
d3bu7a1 355 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si 4e-05
d2d40a1308 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es 7e-09
d2d40a1 308 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es 8e-09
d1dgwa_178 b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( 9e-09
d1uija1170 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea 1e-08
d1v70a_105 b.82.1.9 (A:) Hypothetical protein TTHA0104 {Therm 1e-08
d1y3ta1330 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci 6e-08
d1y3ta1 330 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci 6e-06
d1yhfa1112 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {S 6e-08
d2phda1351 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps 8e-08
d2phda1 351 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps 1e-05
d2bnma2122 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid 2e-07
d1rc6a_253 b.82.1.11 (A:) Hypothetical protein YlbA {Escheric 2e-07
d1rc6a_253 b.82.1.11 (A:) Hypothetical protein YlbA {Escheric 0.002
d1vj2a_114 b.82.1.10 (A:) Hypothetical protein TM1459 {Thermo 4e-07
d2b8ma1108 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {A 1e-06
d1uika1203 b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb 1e-06
d1sq4a_273 b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { 2e-06
d1sq4a_273 b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { 6e-04
d1o4ta_115 b.82.1.9 (A:) Hypothetical protein TM1287 {Thermot 3e-06
d1j58a_372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 4e-06
d1j58a_ 372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 0.002
d1sefa_250 b.82.1.11 (A:) Hypothetical protein EF2996 {Entero 5e-06
d1sefa_250 b.82.1.11 (A:) Hypothetical protein EF2996 {Entero 0.001
d2gm6a1192 b.82.1.19 (A:11-202) Cysteine dioxygenase type I { 9e-06
d1x82a_190 b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI { 9e-06
d2f4pa1134 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Th 1e-05
d1juha_348 b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill 5e-05
d2phla1200 b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc 2e-04
d1sfna_245 b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc 4e-04
d2et1a1201 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare 0.001
d2pyta1128 b.82.1.24 (A:100-227) Ethanolamine utilization pro 0.001
d2o1qa1144 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA 0.004
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Length = 160 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Auxin binding protein
species: Maize (Zea mays) [TaxId: 4577]

 Score =  175 bits (445), Expect = 3e-57
 Identities = 106/154 (68%), Positives = 131/154 (85%), Gaps = 1/154 (0%)

Query: 33  PLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFI 92
            LVR+IS++PQ +YG EGL+HITVAG++ HGMKE+EVWLQT SPG RTPIHRHSCEE+F 
Sbjct: 7   SLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFT 66

Query: 93  VLKGSGTLYLASSSHEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISR 152
           VLKG GTL + SSS + +PG+PQE  FF N+TF IPVND HQVWN++E+EDLQ+LV+ISR
Sbjct: 67  VLKGKGTLLMGSSSLK-YPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISR 125

Query: 153 PPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSP 186
           PP K+F+Y+DWSMPHTAA LKFP+ WDE C ++ 
Sbjct: 126 PPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAA 159
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Length = 105 Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Length = 112 Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Length = 122 Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Length = 114 Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 108 Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Length = 115 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Length = 192 Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 190 Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Length = 134 Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Length = 128 Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Length = 144 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 99.97
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 99.75
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 99.73
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 99.71
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 99.69
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 99.68
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 99.67
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 99.57
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 99.53
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 99.53
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 99.52
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.51
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 99.5
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 99.46
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 99.46
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 99.42
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 99.38
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 99.38
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 99.38
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 99.35
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 99.35
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 99.34
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 99.33
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 99.29
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 99.25
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 99.18
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 99.17
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 99.16
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 99.14
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 99.14
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 99.12
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 99.12
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 99.12
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 99.1
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.05
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 99.04
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 99.02
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 99.0
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 98.97
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 98.95
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 98.83
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 98.65
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 98.65
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 98.62
d2o1qa1144 Putative acetyl/propionyl-CoA carboxylase subunit 98.57
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 98.42
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 98.4
d3elna1186 Cysteine dioxygenase type I {Rattus norvegicus [Ta 98.31
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 98.1
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 97.96
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 97.88
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 97.7
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 97.51
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 97.0
d1tq5a1231 Hypothetical protein YhhW {Escherichia coli [TaxId 96.84
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac 95.82
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 95.8
d1eyba_ 439 Homogentisate dioxygenase {Human (Homo sapiens) [T 95.58
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 95.49
d1pmia_440 Phosphomannose isomerase {Yeast (Candida albicans) 95.04
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone 95.0
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto 94.83
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 94.83
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc 94.32
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom 94.07
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces 93.92
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 93.73
d1j1la_ 288 Pirin {Human (Homo sapiens) [TaxId: 9606]} 93.28
d1ywka1260 5-keto-4-deoxyuronate isomerase KduI {Enterococcus 93.05
d3dl3a196 Tellurite resistance protein B, TehB {Vibrio fisch 92.51
d1j1la_288 Pirin {Human (Homo sapiens) [TaxId: 9606]} 92.06
d1tq5a1231 Hypothetical protein YhhW {Escherichia coli [TaxId 91.81
d3bb6a1109 Uncharacterized protein YeaR {Escherichia coli [Ta 90.66
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 90.53
d2oyza193 Uncharacterized protein VPA0057 {Vibrio parahaemol 90.25
d1e5ra_290 Type II Proline 3-hydroxylase (proline oxidase) {S 90.01
d1xrua1277 5-keto-4-deoxyuronate isomerase KduI {Escherichia 88.9
d1ywka1260 5-keto-4-deoxyuronate isomerase KduI {Enterococcus 88.69
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 88.53
d1xrua1 277 5-keto-4-deoxyuronate isomerase KduI {Escherichia 88.09
d1znpa1140 Hypothetical protein Atu3615 {Agrobacterium tumefa 87.87
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 85.56
d1ylla1195 Hypothetical protein PA5104 {Pseudomonas aeruginos 85.5
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 84.65
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 83.51
d1pmia_440 Phosphomannose isomerase {Yeast (Candida albicans) 81.2
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 80.95
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 80.7
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Auxin binding protein
species: Maize (Zea mays) [TaxId: 4577]

Probab=99.97  E-value=2.3e-30  Score=200.49  Aligned_cols=158  Identities=68%  Similarity=1.229  Sum_probs=138.7

Q ss_pred             CcccCCCeeEecCCCCCCccCCCCcEEEEEEeeccCCceeEEEEEEEECCCCcCCceecCCcEEEEEEeCEEEEEECCee
Q 029565           27 CSIKGFPLVRNISELPQDNYGREGLAHITVAGSILHGMKEIEVWLQTFSPGTRTPIHRHSCEEIFIVLKGSGTLYLASSS  106 (191)
Q Consensus        27 ~~~~~~~~V~~i~d~~~~~~~~~G~~~~~~~~~~~~g~~~~~~~~~~i~PG~~~~~H~H~~eE~~~Vl~G~~~v~i~~~~  106 (191)
                      |++.. .+|+++++.++..++.+|.....+......|.+.+++.+.+++||+..+.|+|..+|++||++|++.+.+++..
T Consensus         2 ~~~d~-~~vr~i~~~~~~~~g~~g~~~~~~~~~~~~g~~~i~v~~~~l~PG~~~~~H~H~~~e~~~Vl~G~g~~~i~~~~   80 (160)
T d1lr5a_           2 CVRDN-SLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSS   80 (160)
T ss_dssp             CCCCC-CSEEEGGGSCCBCTTCTTEEEEEEECHHHHCCSSEEEEEEEECTTCBCCEEEESSCEEEEEEECCEEEEECCSS
T ss_pred             CCccc-hhhcchhhCcccccCCCCceEEEeecccCCCccEEEEEEEEECCCccccceeccccEEEEEEeeeEEEEECCcc
Confidence            54444 48999999999888889988887776556677789999999999999999999999999999999999999855


Q ss_pred             eecCCCCCceeeecCCeEEEECCCCcEEEEeCCCCCcEEEEEEEeCCCceeeecCCCCCcccccccCccccccccCCCCC
Q 029565          107 HEKHPGKPQEHFFFANSTFHIPVNDAHQVWNTNENEDLQMLVVISRPPVKVFIYEDWSMPHTAAKLKFPYFWDEQCLQSP  186 (191)
Q Consensus       107 ~~l~~gk~~d~~l~~GD~v~ip~g~~H~~~N~g~~e~~~~l~v~~~p~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~  186 (191)
                      ... .++++.+.+++||++++|+|++|+++|.|++|+++++++.++++.+.++|+||.++.+++++++|++|+++|-|++
T Consensus        81 ~~~-~~~~~~~~l~~Gd~~~iP~~~~H~~~N~g~~E~l~~l~i~~~~p~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~  159 (160)
T d1lr5a_          81 LKY-PGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAA  159 (160)
T ss_dssp             SSS-CCSCEEEEECTTEEEEECTTCCEEEECCCSSSCEEEEEEEESSSCCEEEESSTTSCGGGCEEESSCTTTHHHHHHT
T ss_pred             ccc-cccceEEEecCCCEEEeCCCCcEEEEECCCCCCEEEEEEECCCCceEEecccccccCCcccccccCCCchhhhccC
Confidence            322 2344568999999999999999999999865799999999999999999999999999999999999999998865
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} Back     information, alignment and structure
>d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ylla1 b.82.1.17 (A:2-196) Hypothetical protein PA5104 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure