Citrus Sinensis ID: 029584


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MQDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD
ccccccccccccEEEEEcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHEEEEEEEccccccEEEEEcccccccccEEEEEcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccEEEccHHHHHHHHHHHHccc
cccccEcHHHcccEEEcccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHEccccccccEEEEEEEEcccEEEEEEEcccccEEEEcEEEEcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEccHHHHHHHHHHHHccc
mqdklldhtsvthlfPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDeecgprlfkcdpaghffghkatsaglKEQEAINFLEKkmkndpaftfQETVQTAISTLQSVLQEdfkaseievgvvskenpefrvLSIEEIDEHLTAISERD
mqdklldhtsvthlfPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASeievgvvskenpefrvlsieeidehltaiserd
MQDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD
******DHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEI***********
MQDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISE**
MQDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD
**DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAIS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
Q9XG77246 Proteasome subunit alpha N/A no 0.989 0.768 0.904 1e-98
O48551246 Proteasome subunit alpha no no 0.989 0.768 0.894 1e-98
O81146246 Proteasome subunit alpha yes no 0.989 0.768 0.835 1e-93
O81147246 Proteasome subunit alpha no no 0.989 0.768 0.835 2e-92
Q9LSU3246 Proteasome subunit alpha yes no 0.989 0.768 0.841 2e-91
Q9QUM9246 Proteasome subunit alpha yes no 0.989 0.768 0.608 2e-65
P60901246 Proteasome subunit alpha yes no 0.989 0.768 0.608 2e-65
P60900246 Proteasome subunit alpha yes no 0.989 0.768 0.608 2e-65
Q2YDE4246 Proteasome subunit alpha yes no 0.989 0.768 0.608 2e-65
Q9XZJ4244 Proteasome subunit alpha yes no 0.942 0.737 0.571 5e-54
>sp|Q9XG77|PSA6_TOBAC Proteasome subunit alpha type-6 OS=Nicotiana tabacum GN=PAA1 PE=2 SV=1 Back     alignment and function desciption
 Score =  358 bits (919), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 180/189 (95%)

Query: 3   DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW 62
           DKLLD TSV+HLFPITKYLGLLATGMTADARTLVQQAR EAAEFRFKYGYEMPVDVL+KW
Sbjct: 58  DKLLDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLSKW 117

Query: 63  IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN 122
           IADKSQVYTQHAYMRPLGVVAM+L IDEE GP+LFKCDPAGHFFGHKATSAG KEQEAIN
Sbjct: 118 IADKSQVYTQHAYMRPLGVVAMILGIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAIN 177

Query: 123 FLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDE 182
           FLEKKMKNDPAF+++ETVQTAIS LQSVLQEDFKASEIEVGVV KE+P FRVL+ EEIDE
Sbjct: 178 FLEKKMKNDPAFSYEETVQTAISALQSVLQEDFKASEIEVGVVKKEDPIFRVLTTEEIDE 237

Query: 183 HLTAISERD 191
           HLTAISERD
Sbjct: 238 HLTAISERD 246




The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Nicotiana tabacum (taxid: 4097)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|O48551|PSA6_SOYBN Proteasome subunit alpha type-6 OS=Glycine max GN=PAA1 PE=2 SV=2 Back     alignment and function description
>sp|O81146|PSA6A_ARATH Proteasome subunit alpha type-6-A OS=Arabidopsis thaliana GN=PAA1 PE=1 SV=2 Back     alignment and function description
>sp|O81147|PSA6B_ARATH Proteasome subunit alpha type-6-B OS=Arabidopsis thaliana GN=PAA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LSU3|PSA6_ORYSJ Proteasome subunit alpha type-6 OS=Oryza sativa subsp. japonica GN=PAA1 PE=2 SV=1 Back     alignment and function description
>sp|Q9QUM9|PSA6_MOUSE Proteasome subunit alpha type-6 OS=Mus musculus GN=Psma6 PE=1 SV=1 Back     alignment and function description
>sp|P60901|PSA6_RAT Proteasome subunit alpha type-6 OS=Rattus norvegicus GN=Psma6 PE=1 SV=1 Back     alignment and function description
>sp|P60900|PSA6_HUMAN Proteasome subunit alpha type-6 OS=Homo sapiens GN=PSMA6 PE=1 SV=1 Back     alignment and function description
>sp|Q2YDE4|PSA6_BOVIN Proteasome subunit alpha type-6 OS=Bos taurus GN=PSMA6 PE=1 SV=1 Back     alignment and function description
>sp|Q9XZJ4|PSA6_DROME Proteasome subunit alpha type-6 OS=Drosophila melanogaster GN=Prosalpha1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
255583952246 proteasome subunit alpha type, putative 0.989 0.768 0.925 2e-99
356545355 368 PREDICTED: proteasome subunit alpha type 0.989 0.513 0.904 5e-98
217075112246 unknown [Medicago truncatula] gi|3885172 0.989 0.768 0.883 5e-97
12229948246 RecName: Full=Proteasome subunit alpha t 0.989 0.768 0.904 6e-97
351721962246 proteasome subunit alpha type-6 [Glycine 0.989 0.768 0.894 6e-97
211906468246 20S proteasome subunit alpha-1 [Gossypiu 0.989 0.768 0.894 3e-96
255648341246 unknown [Glycine max] 0.989 0.768 0.894 4e-96
225442079246 PREDICTED: proteasome subunit alpha type 0.989 0.768 0.888 7e-96
449447912246 PREDICTED: proteasome subunit alpha type 0.989 0.768 0.894 7e-96
388519097246 unknown [Lotus japonicus] 0.989 0.768 0.883 4e-95
>gi|255583952|ref|XP_002532723.1| proteasome subunit alpha type, putative [Ricinus communis] gi|223527531|gb|EEF29654.1| proteasome subunit alpha type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/189 (92%), Positives = 181/189 (95%)

Query: 3   DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW 62
           DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQAR EAAEFRFKYGYEMPVDVLAKW
Sbjct: 58  DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLAKW 117

Query: 63  IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN 122
           IADKSQ+YTQHAYMRPLGVVAMVL ID+E GPRL+KCDPAGHFFGHKATSAGLKEQEAIN
Sbjct: 118 IADKSQIYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFGHKATSAGLKEQEAIN 177

Query: 123 FLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDE 182
           FLEKKMKNDPAFT++ETVQTAIS LQSVLQEDFKA+EIEVGVV  ENP FRVLS EEIDE
Sbjct: 178 FLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVRTENPVFRVLSTEEIDE 237

Query: 183 HLTAISERD 191
           HLTAISERD
Sbjct: 238 HLTAISERD 246




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356545355|ref|XP_003541109.1| PREDICTED: proteasome subunit alpha type-6-like [Glycine max] Back     alignment and taxonomy information
>gi|217075112|gb|ACJ85916.1| unknown [Medicago truncatula] gi|388517215|gb|AFK46669.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|12229948|sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S proteasome alpha subunit A; AltName: Full=20S proteasome subunit alpha-1 gi|4539545|emb|CAB39975.1| PRCI [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|351721962|ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max] gi|12229897|sp|O48551.2|PSA6_SOYBN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S proteasome alpha subunit A; AltName: Full=20S proteasome subunit alpha-1; AltName: Full=Proteasome iota subunit gi|3377794|gb|AAC28135.1| proteasome IOTA subunit [Glycine max] Back     alignment and taxonomy information
>gi|211906468|gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|255648341|gb|ACU24622.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225442079|ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Vitis vinifera] gi|147797489|emb|CAN73517.1| hypothetical protein VITISV_005460 [Vitis vinifera] gi|297742984|emb|CBI35851.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449447912|ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus] gi|449480500|ref|XP_004155912.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388519097|gb|AFK47610.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
TAIR|locus:2157106246 PAA1 "proteasome alpha subunit 0.989 0.768 0.835 1.9e-83
TAIR|locus:2064727246 PAA2 "20S proteasome subunit P 0.989 0.768 0.835 2.8e-82
UNIPROTKB|E2RMN2246 PSMA6 "Proteasome subunit alph 0.989 0.768 0.613 7.3e-59
UNIPROTKB|Q2YDE4246 PSMA6 "Proteasome subunit alph 0.989 0.768 0.608 1.5e-58
UNIPROTKB|B4DXJ9227 PSMA6 "cDNA FLJ51729, highly s 0.989 0.832 0.608 1.5e-58
UNIPROTKB|P60900246 PSMA6 "Proteasome subunit alph 0.989 0.768 0.608 1.5e-58
UNIPROTKB|F2Z5N0246 PSMA6 "Proteasome subunit alph 0.989 0.768 0.608 1.5e-58
MGI|MGI:1347006246 Psma6 "proteasome (prosome, ma 0.989 0.768 0.608 1.5e-58
RGD|61849246 Psma6 "proteasome (prosome, ma 0.989 0.768 0.608 1.5e-58
ZFIN|ZDB-GENE-020326-1246 psma6a "proteasome (prosome, m 0.989 0.768 0.603 3.2e-58
TAIR|locus:2157106 PAA1 "proteasome alpha subunit A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 836 (299.3 bits), Expect = 1.9e-83, P = 1.9e-83
 Identities = 158/189 (83%), Positives = 176/189 (93%)

Query:     3 DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW 62
             DKLLD +SVTHLFPITKY+GL+ATG+TADAR+LVQQAR +AAEFRF YGYEMPVD+LAKW
Sbjct:    58 DKLLDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKW 117

Query:    63 IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN 122
             IADKSQVYTQHAYMRPLGVVAMV+ +DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+N
Sbjct:   118 IADKSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVN 177

Query:   123 FLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDE 182
             FLEKKMK +P+FTF ETVQTAIS LQSVLQEDFKA+EIEVGVV  ENPEFR L+ EEI+E
Sbjct:   178 FLEKKMKENPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEE 237

Query:   183 HLTAISERD 191
             HLTAISERD
Sbjct:   238 HLTAISERD 246




GO:0004175 "endopeptidase activity" evidence=IEA
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005839 "proteasome core complex" evidence=IEA;TAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA;TAS
GO:0008233 "peptidase activity" evidence=ISS
GO:0019773 "proteasome core complex, alpha-subunit complex" evidence=IEA
GO:0051603 "proteolysis involved in cellular protein catabolic process" evidence=IEA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0010043 "response to zinc ion" evidence=IEP
GO:0000502 "proteasome complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2064727 PAA2 "20S proteasome subunit PAA2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMN2 PSMA6 "Proteasome subunit alpha type" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2YDE4 PSMA6 "Proteasome subunit alpha type-6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4DXJ9 PSMA6 "cDNA FLJ51729, highly similar to Proteasome subunit alpha type 6 (EC 3.4.25.1)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P60900 PSMA6 "Proteasome subunit alpha type-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5N0 PSMA6 "Proteasome subunit alpha type" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1347006 Psma6 "proteasome (prosome, macropain) subunit, alpha type 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61849 Psma6 "proteasome (prosome, macropain) subunit, alpha type 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020326-1 psma6a "proteasome (prosome, macropain) subunit, alpha type, 6a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9QUM9PSA6_MOUSE3, ., 4, ., 2, 5, ., 10.60840.98950.7682yesno
Q9XZJ4PSA6_DROME3, ., 4, ., 2, 5, ., 10.57140.94240.7377yesno
O94517PSA1_SCHPO3, ., 4, ., 2, 5, ., 10.54450.97900.7663yesno
Q9LSU3PSA6_ORYSJ3, ., 4, ., 2, 5, ., 10.84120.98950.7682yesno
O81146PSA6A_ARATH3, ., 4, ., 2, 5, ., 10.83590.98950.7682yesno
Q2YDE4PSA6_BOVIN3, ., 4, ., 2, 5, ., 10.60840.98950.7682yesno
Q9XG77PSA6_TOBAC3, ., 4, ., 2, 5, ., 10.90470.98950.7682N/Ano
P60901PSA6_RAT3, ., 4, ., 2, 5, ., 10.60840.98950.7682yesno
P60900PSA6_HUMAN3, ., 4, ., 2, 5, ., 10.60840.98950.7682yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.25.10.991
3rd Layer3.4.250.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034058001
RecName- Full=Proteasome subunit alpha type; EC=3.4.25.1;; The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) (246 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00015420001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (191 aa)
   0.945
GSVIVG00024499001
RecName- Full=Proteasome subunit beta type; EC=3.4.25.1;; The proteasome is a multicatalytic pr [...] (245 aa)
   0.945
GSVIVG00014791001
SubName- Full=Putative uncharacterized protein (Chromosome chr18 scaffold_1, whole genome shotg [...] (309 aa)
    0.932
GSVIVG00023752001
SubName- Full=Putative uncharacterized protein (Chromosome chr7 scaffold_31, whole genome shotg [...] (205 aa)
   0.926
GSVIVG00010470001
SubName- Full=Chromosome chr17 scaffold_263, whole genome shotgun sequence; (386 aa)
     0.911
GSVIVG00026350001
RecName- Full=Proteasome subunit beta type; EC=3.4.25.1;; The proteasome is a multicatalytic pr [...] (223 aa)
   0.901
GSVIVG00030725001
RecName- Full=Proteasome subunit beta type; EC=3.4.25.1;; The proteasome is a multicatalytic pr [...] (250 aa)
   0.899
GSVIVG00035048001
RecName- Full=Proteasome subunit beta type; EC=3.4.25.1;; The proteasome is a multicatalytic pr [...] (272 aa)
    0.879
GSVIVG00036762001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (440 aa)
    0.845
GSVIVG00006696001
SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (267 aa)
    0.798

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
cd03754215 cd03754, proteasome_alpha_type_6, proteasome_alpha 1e-103
cd01911209 cd01911, proteasome_alpha, proteasome alpha subuni 4e-82
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 2e-48
pfam00227188 pfam00227, Proteasome, Proteasome subunit 6e-47
PRK03996241 PRK03996, PRK03996, proteasome subunit alpha; Prov 2e-45
TIGR03633224 TIGR03633, arc_protsome_A, proteasome endopeptidas 2e-42
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 1e-39
cd03750227 cd03750, proteasome_alpha_type_2, proteasome_alpha 3e-39
cd03756211 cd03756, proteasome_alpha_archeal, proteasome_alph 7e-37
cd03749211 cd03749, proteasome_alpha_type_1, proteasome_alpha 1e-30
PTZ00246253 PTZ00246, PTZ00246, proteasome subunit alpha; Prov 6e-28
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 2e-27
cd03752213 cd03752, proteasome_alpha_type_4, proteasome_alpha 6e-27
cd03755207 cd03755, proteasome_alpha_type_7, proteasome_alpha 8e-25
cd03751212 cd03751, proteasome_alpha_type_3, proteasome_alpha 1e-24
cd03753213 cd03753, proteasome_alpha_type_5, proteasome_alpha 6e-24
cd03764188 cd03764, proteasome_beta_archeal, Archeal proteaso 3e-11
TIGR03634185 TIGR03634, arc_protsome_B, proteasome endopeptidas 3e-10
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 3e-09
cd03757212 cd03757, proteasome_beta_type_1, proteasome beta t 0.001
>gnl|CDD|239723 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6 Back     alignment and domain information
 Score =  296 bits (759), Expect = e-103
 Identities = 112/167 (67%), Positives = 140/167 (83%), Gaps = 2/167 (1%)

Query: 1   MQDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLA 60
           + DKL+D ++VTHLF IT  +G + TGM AD+R+ VQ+ARYEAAEF++KYGYEMPVDVLA
Sbjct: 49  VPDKLIDPSTVTHLFRITDEIGCVMTGMIADSRSQVQRARYEAAEFKYKYGYEMPVDVLA 108

Query: 61  KWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEA 120
           K IAD +QVYTQHAYMRPLGV  +++ IDEE GP+L+KCDPAG+F G+KAT+AG+KEQEA
Sbjct: 109 KRIADINQVYTQHAYMRPLGVSMILIGIDEELGPQLYKCDPAGYFAGYKATAAGVKEQEA 168

Query: 121 INFLEKKMKNDPAF--TFQETVQTAISTLQSVLQEDFKASEIEVGVV 165
            NFLEKK+K  P    +++ETV+ AIS LQ+VL  DFKA+EIEVGVV
Sbjct: 169 TNFLEKKLKKKPDLIESYEETVELAISCLQTVLSTDFKATEIEVGVV 215


The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 215

>gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|235192 PRK03996, PRK03996, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239719 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2 Back     alignment and domain information
>gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal Back     alignment and domain information
>gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 Back     alignment and domain information
>gnl|CDD|173491 PTZ00246, PTZ00246, proteasome subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|239721 cd03752, proteasome_alpha_type_4, proteasome_alpha_type_4 Back     alignment and domain information
>gnl|CDD|239724 cd03755, proteasome_alpha_type_7, proteasome_alpha_type_7 Back     alignment and domain information
>gnl|CDD|239720 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3 Back     alignment and domain information
>gnl|CDD|239722 cd03753, proteasome_alpha_type_5, proteasome_alpha_type_5 Back     alignment and domain information
>gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit Back     alignment and domain information
>gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|239726 cd03757, proteasome_beta_type_1, proteasome beta type-1 subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 100.0
KOG0176241 consensus 20S proteasome, regulatory subunit alpha 100.0
KOG0182246 consensus 20S proteasome, regulatory subunit alpha 100.0
PRK03996241 proteasome subunit alpha; Provisional 100.0
PTZ00246253 proteasome subunit alpha; Provisional 100.0
COG0638236 PRE1 20S proteasome, alpha and beta subunits [Post 100.0
KOG0181233 consensus 20S proteasome, regulatory subunit alpha 100.0
TIGR03690219 20S_bact_beta proteasome, beta subunit, bacterial 100.0
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 100.0
KOG0183249 consensus 20S proteasome, regulatory subunit alpha 100.0
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 100.0
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 100.0
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 100.0
PTZ00488247 Proteasome subunit beta type-5; Provisional 100.0
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 100.0
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 100.0
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 100.0
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 100.0
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 100.0
KOG0178249 consensus 20S proteasome, regulatory subunit alpha 100.0
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 100.0
KOG0863264 consensus 20S proteasome, regulatory subunit alpha 100.0
TIGR03691228 20S_bact_alpha proteasome, alpha subunit, bacteria 100.0
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 100.0
cd03757212 proteasome_beta_type_1 proteasome beta type-1 subu 100.0
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 100.0
cd03765236 proteasome_beta_bacterial Bacterial proteasome, be 100.0
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 100.0
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 100.0
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 100.0
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 100.0
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 100.0
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 100.0
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 100.0
KOG0184254 consensus 20S proteasome, regulatory subunit alpha 100.0
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 100.0
KOG0175285 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0177200 consensus 20S proteasome, regulatory subunit beta 100.0
KOG0179235 consensus 20S proteasome, regulatory subunit beta 99.98
KOG0185256 consensus 20S proteasome, regulatory subunit beta 99.96
KOG0174224 consensus 20S proteasome, regulatory subunit beta 99.96
KOG0173271 consensus 20S proteasome, regulatory subunit beta 99.95
KOG0180204 consensus 20S proteasome, regulatory subunit beta 99.94
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 99.94
PRK05456172 ATP-dependent protease subunit HslV; Provisional 99.93
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 99.93
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 99.92
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 99.01
COG3484255 Predicted proteasome-type protease [Posttranslatio 97.42
KOG3361157 consensus Iron binding protein involved in Fe-S cl 87.39
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
Probab=100.00  E-value=2e-44  Score=286.16  Aligned_cols=179  Identities=35%  Similarity=0.583  Sum_probs=170.9

Q ss_pred             CCccccCCCCcceEEecCcEEEEEecchHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhhcCcccccc
Q 029584            2 QDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGV   81 (191)
Q Consensus         2 ~s~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~t~~~~~rP~~v   81 (191)
                      .++|+.+++.+||++|++|++|++||+.+|++.+.+++|.+++.|++++|++++++.++++|++.+|+|+++++.|||+|
T Consensus        48 ~~~l~~~~~~~KI~~I~~~i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~~~~~t~~~~~rP~~v  127 (227)
T cd03750          48 PSPLIDESSVHKVEQITPHIGMVYSGMGPDFRVLVKKARKIAQQYYLVYGEPIPVSQLVREIASVMQEYTQSGGVRPFGV  127 (227)
T ss_pred             CccccCCCCcceEEEEcCCEEEEEeEcHHhHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCCCCCCChhe
Confidence            36788889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEEEEEcCCCCCeEEEECCCcceeceeeeecCCChHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHhhhcccCCCCeEE
Q 029584           82 VAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIE  161 (191)
Q Consensus        82 ~~iv~G~d~~~~p~Ly~~d~~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~~~s~eea~~l~~~~l~~~~~~d~~~~~ie  161 (191)
                      ++||+|||+ .||+||.+||+|++.+++++|+|+|++.++++||++|+  ++||++||++++++||+.+.+|++...+++
T Consensus       128 ~~li~G~D~-~g~~Ly~~d~~G~~~~~~~~a~G~g~~~~~~~Le~~~~--~~ms~eeai~l~~~~l~~~~~~~l~~~~ie  204 (227)
T cd03750         128 SLLIAGWDE-GGPYLYQVDPSGSYFTWKATAIGKNYSNAKTFLEKRYN--EDLELEDAIHTAILTLKEGFEGQMTEKNIE  204 (227)
T ss_pred             EEEEEEEeC-CCCEEEEECCCCCEEeeeEEEECCCCHHHHHHHHhhcc--CCCCHHHHHHHHHHHHHHHhcccCCCCcEE
Confidence            999999997 68999999999999999999999999999999999984  789999999999999999999888777999


Q ss_pred             EEEEEeCCCcEEEcCHHHHHHHH
Q 029584          162 VGVVSKENPEFRVLSIEEIDEHL  184 (191)
Q Consensus       162 i~iv~~~~~~~~~~~~~~i~~~~  184 (191)
                      |+++++++ ++++++++||++++
T Consensus       205 v~iv~~~~-~~~~~~~~ei~~~~  226 (227)
T cd03750         205 IGICGETK-GFRLLTPAEIKDYL  226 (227)
T ss_pred             EEEEECCC-CEEECCHHHHHHHh
Confidence            99999874 49999999999986



The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.

>KOG0176 consensus 20S proteasome, regulatory subunit alpha type PSMA5/PUP2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0182 consensus 20S proteasome, regulatory subunit alpha type PSMA6/SCL1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0181 consensus 20S proteasome, regulatory subunit alpha type PSMA2/PRE8 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>KOG0183 consensus 20S proteasome, regulatory subunit alpha type PSMA7/PRE6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>KOG0178 consensus 20S proteasome, regulatory subunit alpha type PSMA4/PRE9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>KOG0863 consensus 20S proteasome, regulatory subunit alpha type PSMA1/PRE5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>KOG0184 consensus 20S proteasome, regulatory subunit alpha type PSMA3/PRE10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>KOG0175 consensus 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0177 consensus 20S proteasome, regulatory subunit beta type PSMB2/PRE1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0179 consensus 20S proteasome, regulatory subunit beta type PSMB1/PRE7 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0185 consensus 20S proteasome, regulatory subunit beta type PSMB4/PRE4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0174 consensus 20S proteasome, regulatory subunit beta type PSMB6/PSMB9/PRE3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0173 consensus 20S proteasome, regulatory subunit beta type PSMB7/PSMB10/PUP1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0180 consensus 20S proteasome, regulatory subunit beta type PSMB3/PUP3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3361 consensus Iron binding protein involved in Fe-S cluster formation [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3unb_G246 Mouse Constitutive 20s Proteasome In Complex With P 2e-66
1iru_A246 Crystal Structure Of The Mammalian 20s Proteasome A 2e-66
1g0u_G252 A Gated Channel Into The Proteasome Core Particle L 7e-43
1ryp_A243 Crystal Structure Of The 20s Proteasome From Yeast 7e-43
3h4p_A264 Proteasome 20s Core Particle From Methanocaldococcu 2e-26
1iru_B233 Crystal Structure Of The Mammalian 20s Proteasome A 1e-23
3jrm_A227 Crystal Structure Of Archaeal 20s Proteasome In Com 1e-23
3unb_A234 Mouse Constitutive 20s Proteasome In Complex With P 1e-23
1yau_A233 Structure Of Archeabacterial 20s Proteasome- Pa26 C 1e-23
2ku1_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 1e-23
1yar_A233 Structure Of Archeabacterial 20s Proteasome Mutant 1e-23
2ku2_A237 Dynamic Regulation Of Archaeal Proteasome Gate Open 1e-23
1pma_A233 Proteasome From Thermoplasma Acidophilum Length = 2 1e-23
1j2q_A237 20s Proteasome In Complex With Calpain-inhibitor I 1e-22
1j2p_A246 Alpha-Ring From The Proteasome From Archaeoglobus F 3e-22
3unb_C248 Mouse Constitutive 20s Proteasome In Complex With P 2e-20
3une_C248 Mouse Constitutive 20s Proteasome Length = 248 2e-20
1iru_D248 Crystal Structure Of The Mammalian 20s Proteasome A 6e-19
1iru_F263 Crystal Structure Of The Mammalian 20s Proteasome A 7e-19
3unb_E263 Mouse Constitutive 20s Proteasome In Complex With P 8e-19
1ryp_B250 Crystal Structure Of The 20s Proteasome From Yeast 4e-18
1vsy_B231 Proteasome Activator Complex Length = 231 4e-18
1vsy_D227 Proteasome Activator Complex Length = 227 1e-17
1ryp_D241 Crystal Structure Of The 20s Proteasome From Yeast 1e-17
1g0u_C243 A Gated Channel Into The Proteasome Core Particle L 1e-17
1fnt_D254 Crystal Structure Of The 20s Proteasome From Yeast 1e-17
1vsy_C232 Proteasome Activator Complex Length = 232 2e-17
1g0u_B245 A Gated Channel Into The Proteasome Core Particle L 2e-17
1ryp_C244 Crystal Structure Of The 20s Proteasome From Yeast 3e-17
3oeu_B235 Structure Of Yeast 20s Open-Gate Proteasome With Co 3e-17
1z7q_C258 Crystal Structure Of The 20s Proteasome From Yeast 3e-17
1iru_C261 Crystal Structure Of The Mammalian 20s Proteasome A 5e-16
3unb_F255 Mouse Constitutive 20s Proteasome In Complex With P 6e-16
1iru_G254 Crystal Structure Of The Mammalian 20s Proteasome A 8e-16
1iru_E241 Crystal Structure Of The Mammalian 20s Proteasome A 2e-15
3unb_D241 Mouse Constitutive 20s Proteasome In Complex With P 2e-15
3unb_B261 Mouse Constitutive 20s Proteasome In Complex With P 4e-15
1fnt_G287 Crystal Structure Of The 20s Proteasome From Yeast 4e-13
1z7q_G288 Crystal Structure Of The 20s Proteasome From Yeast 5e-13
3oeu_F242 Structure Of Yeast 20s Open-Gate Proteasome With Co 5e-13
1g0u_D241 A Gated Channel Into The Proteasome Core Particle L 5e-13
1g0u_F248 A Gated Channel Into The Proteasome Core Particle L 5e-13
1ryp_G244 Crystal Structure Of The 20s Proteasome From Yeast 5e-13
1vsy_E250 Proteasome Activator Complex Length = 250 1e-12
4g4s_E261 Structure Of Proteasome-Pba1-Pba2 Complex Length = 2e-12
1fnt_E260 Crystal Structure Of The 20s Proteasome From Yeast 2e-12
2z5c_C262 Crystal Structure Of A Novel Chaperone Complex For 2e-12
1ryp_E242 Crystal Structure Of The 20s Proteasome From Yeast 2e-12
3sdi_E233 Structure Of Yeast 20s Open-Gate Proteasome With Co 1e-09
1g0u_E234 A Gated Channel Into The Proteasome Core Particle L 1e-09
1ryp_F233 Crystal Structure Of The 20s Proteasome From Yeast 7e-09
1fnt_F234 Crystal Structure Of The 20s Proteasome From Yeast 8e-09
4g4s_F235 Structure Of Proteasome-Pba1-Pba2 Complex Length = 8e-09
3c91_H203 Thermoplasma Acidophilum 20s Proteasome With An Ope 2e-06
1ya7_H217 Implications For Interactions Of Proteasome With Pa 2e-06
1pma_B211 Proteasome From Thermoplasma Acidophilum Length = 2 2e-06
>pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 246 Back     alignment and structure

Iteration: 1

Score = 248 bits (633), Expect = 2e-66, Method: Compositional matrix adjust. Identities = 115/189 (60%), Positives = 155/189 (82%) Query: 3 DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW 62 DKLLD ++VTHLF IT+ +G + TGMTAD+R+ VQ+ARYEAA +++KYGYE+PVD+L K Sbjct: 58 DKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKR 117 Query: 63 IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN 122 IAD SQVYTQ+A MRPLG +++ IDEE GP+++KCDPAG++ G KAT+AG+K+ E+ + Sbjct: 118 IADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTS 177 Query: 123 FLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDE 182 FLEKK+K +TF++TV+TAI+ L +VL DFK SEIEVGVV+ ENP+FR+L+ EID Sbjct: 178 FLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDA 237 Query: 183 HLTAISERD 191 HL A++ERD Sbjct: 238 HLVALAERD 246
>pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 246 Back     alignment and structure
>pdb|1G0U|G Chain G, A Gated Channel Into The Proteasome Core Particle Length = 252 Back     alignment and structure
>pdb|1RYP|A Chain A, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 243 Back     alignment and structure
>pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 Back     alignment and structure
>pdb|1IRU|B Chain B, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 233 Back     alignment and structure
>pdb|3JRM|A Chain A, Crystal Structure Of Archaeal 20s Proteasome In Complex With Mutated P26 Activator Length = 227 Back     alignment and structure
>pdb|3UNB|A Chain A, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 Back     alignment and structure
>pdb|1YAU|A Chain A, Structure Of Archeabacterial 20s Proteasome- Pa26 Complex Length = 233 Back     alignment and structure
>pdb|2KU1|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>pdb|1YAR|A Chain A, Structure Of Archeabacterial 20s Proteasome Mutant D9s- Pa26 Complex Length = 233 Back     alignment and structure
>pdb|2KU2|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 Back     alignment and structure
>pdb|1PMA|A Chain A, Proteasome From Thermoplasma Acidophilum Length = 233 Back     alignment and structure
>pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 Back     alignment and structure
>pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 Back     alignment and structure
>pdb|3UNB|C Chain C, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 248 Back     alignment and structure
>pdb|3UNE|C Chain C, Mouse Constitutive 20s Proteasome Length = 248 Back     alignment and structure
>pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 Back     alignment and structure
>pdb|1IRU|F Chain F, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 263 Back     alignment and structure
>pdb|3UNB|E Chain E, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 263 Back     alignment and structure
>pdb|1RYP|B Chain B, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 250 Back     alignment and structure
>pdb|1VSY|B Chain B, Proteasome Activator Complex Length = 231 Back     alignment and structure
>pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 Back     alignment and structure
>pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 Back     alignment and structure
>pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 Back     alignment and structure
>pdb|1VSY|C Chain C, Proteasome Activator Complex Length = 232 Back     alignment and structure
>pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 Back     alignment and structure
>pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>pdb|3OEU|B Chain B, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 235 Back     alignment and structure
>pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 Back     alignment and structure
>pdb|3UNB|F Chain F, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 255 Back     alignment and structure
>pdb|1IRU|G Chain G, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 254 Back     alignment and structure
>pdb|1IRU|E Chain E, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 241 Back     alignment and structure
>pdb|3UNB|D Chain D, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 241 Back     alignment and structure
>pdb|3UNB|B Chain B, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 261 Back     alignment and structure
>pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 287 Back     alignment and structure
>pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 288 Back     alignment and structure
>pdb|3OEU|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 242 Back     alignment and structure
>pdb|1G0U|D Chain D, A Gated Channel Into The Proteasome Core Particle Length = 241 Back     alignment and structure
>pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle Length = 248 Back     alignment and structure
>pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 Back     alignment and structure
>pdb|1VSY|E Chain E, Proteasome Activator Complex Length = 250 Back     alignment and structure
>pdb|4G4S|E Chain E, Structure Of Proteasome-Pba1-Pba2 Complex Length = 261 Back     alignment and structure
>pdb|1FNT|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 260 Back     alignment and structure
>pdb|2Z5C|C Chain C, Crystal Structure Of A Novel Chaperone Complex For Yeast 20s Proteasome Assembly Length = 262 Back     alignment and structure
>pdb|1RYP|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 242 Back     alignment and structure
>pdb|3SDI|E Chain E, Structure Of Yeast 20s Open-Gate Proteasome With Compound 20 Length = 233 Back     alignment and structure
>pdb|1G0U|E Chain E, A Gated Channel Into The Proteasome Core Particle Length = 234 Back     alignment and structure
>pdb|1RYP|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 Back     alignment and structure
>pdb|1FNT|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 234 Back     alignment and structure
>pdb|4G4S|F Chain F, Structure Of Proteasome-Pba1-Pba2 Complex Length = 235 Back     alignment and structure
>pdb|3C91|H Chain H, Thermoplasma Acidophilum 20s Proteasome With An Open Gate Length = 203 Back     alignment and structure
>pdb|1YA7|H Chain H, Implications For Interactions Of Proteasome With Pan And Pa700 From The 1.9 A Structure Of A Proteasome-11s Activator Complex Length = 217 Back     alignment and structure
>pdb|1PMA|B Chain B, Proteasome From Thermoplasma Acidophilum Length = 211 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
1iru_A246 20S proteasome; cell cycle, immune response, prote 5e-92
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 1e-87
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 1e-84
1iru_D248 20S proteasome; cell cycle, immune response, prote 3e-84
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 3e-83
1iru_B233 20S proteasome; cell cycle, immune response, prote 8e-83
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 1e-82
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 3e-82
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 6e-82
1iru_E241 20S proteasome; cell cycle, immune response, prote 6e-80
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 7e-80
1iru_C261 20S proteasome; cell cycle, immune response, prote 1e-79
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 2e-79
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 4e-79
1iru_F263 20S proteasome; cell cycle, immune response, prote 4e-79
1iru_G254 20S proteasome; cell cycle, immune response, prote 2e-77
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 4e-72
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 1e-71
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 8e-30
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 2e-26
3unf_H234 Proteasome subunit beta type-10; antigen presentat 4e-21
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 5e-20
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 3e-19
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 8e-19
1iru_I234 20S proteasome; cell cycle, immune response, prote 2e-17
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 2e-15
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 4e-15
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 7e-15
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 5e-14
1iru_L204 20S proteasome; cell cycle, immune response, prote 7e-13
1iru_L204 20S proteasome; cell cycle, immune response, prote 1e-12
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 3e-12
1iru_H205 20S proteasome; cell cycle, immune response, prote 3e-12
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 4e-12
1iru_K201 20S proteasome; cell cycle, immune response, prote 1e-11
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 2e-11
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 7e-11
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 7e-11
3unf_N199 Proteasome subunit beta type-9; antigen presentati 7e-11
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 4e-10
1iru_M213 20S proteasome; cell cycle, immune response, prote 7e-10
1iru_J205 20S proteasome; cell cycle, immune response, prote 3e-09
1iru_N219 20S proteasome; cell cycle, immune response, prote 4e-09
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 1e-08
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 1e-07
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 Back     alignment and structure
 Score =  267 bits (686), Expect = 5e-92
 Identities = 115/190 (60%), Positives = 155/190 (81%)

Query: 2   QDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAK 61
            DKLLD ++VTHLF IT+ +G + TGMTAD+R+ VQ+ARYEAA +++KYGYE+PVD+L K
Sbjct: 57  PDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCK 116

Query: 62  WIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAI 121
            IAD SQVYTQ+A MRPLG   +++ IDEE GP+++KCDPAG++ G KAT+AG+K+ E+ 
Sbjct: 117 RIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTEST 176

Query: 122 NFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEID 181
           +FLEKK+K    +TF++TV+TAI+ L +VL  DFK SEIEVGVV+ ENP+FR+L+  EID
Sbjct: 177 SFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEID 236

Query: 182 EHLTAISERD 191
            HL A++ERD
Sbjct: 237 AHLVALAERD 246


>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_A246 20S proteasome; cell cycle, immune response, prote 100.0
1iru_B233 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_C261 20S proteasome; cell cycle, immune response, prote 100.0
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 100.0
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 100.0
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 100.0
3h4p_a219 Proteasome subunit beta; core particle, cytoplasm, 100.0
1iru_D248 20S proteasome; cell cycle, immune response, prote 100.0
1iru_G254 20S proteasome; cell cycle, immune response, prote 100.0
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 100.0
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 100.0
1iru_F263 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_E241 20S proteasome; cell cycle, immune response, prote 100.0
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 100.0
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 100.0
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 100.0
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 100.0
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 100.0
1iru_L204 20S proteasome; cell cycle, immune response, prote 100.0
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_H205 20S proteasome; cell cycle, immune response, prote 100.0
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 100.0
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 100.0
1iru_N219 20S proteasome; cell cycle, immune response, prote 100.0
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 100.0
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 100.0
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 100.0
3unf_H234 Proteasome subunit beta type-10; antigen presentat 100.0
3unf_N199 Proteasome subunit beta type-9; antigen presentati 100.0
1iru_M213 20S proteasome; cell cycle, immune response, prote 100.0
1iru_K201 20S proteasome; cell cycle, immune response, prote 100.0
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 100.0
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 100.0
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_J205 20S proteasome; cell cycle, immune response, prote 100.0
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 100.0
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 100.0
1iru_I234 20S proteasome; cell cycle, immune response, prote 100.0
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 99.97
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 99.97
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 99.97
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
Probab=100.00  E-value=2.7e-46  Score=298.60  Aligned_cols=188  Identities=47%  Similarity=0.776  Sum_probs=177.9

Q ss_pred             CCccccCCCCcceEEecCcEEEEEecchHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhhcCcccccc
Q 029584            2 QDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGV   81 (191)
Q Consensus         2 ~s~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~t~~~~~rP~~v   81 (191)
                      +++|+.+++++||++|++|++|+++|+.+|++.+.++++.+++.|+++++++++++.+++++++++|.|++++++|||+|
T Consensus        51 ~~~l~~~~~~~Ki~~i~~~i~~~~aG~~aD~~~l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~l~~y~~~~~~rP~~v  130 (243)
T 1ryp_A           51 PDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGV  130 (243)
T ss_dssp             CCTTBCGGGCCSEEECSSSCEEEEESCHHHHHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHHHHBTTSCCCSC
T ss_pred             CccccCCCcCCceEEECCCEEEEEEecHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHhccCCccccce
Confidence            46888899999999999999999999999999999999999999999999999999999999999999999989999999


Q ss_pred             eeEEEEEcCCCCCeEEEECCCcceeceeeeecCCChHHHHHHHHHhhcCCC-----CCCHHHHHHHHHHHHHhhhcccCC
Q 029584           82 VAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDP-----AFTFQETVQTAISTLQSVLQEDFK  156 (191)
Q Consensus        82 ~~iv~G~d~~~~p~Ly~~d~~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~-----~~s~eea~~l~~~~l~~~~~~d~~  156 (191)
                      ++||||||+++||+||.+||+|++.+++++|+|+|++.++++||+.|++.+     +||++||++++++||..+.+||..
T Consensus       131 ~~lvaG~D~~~gp~Ly~~dp~G~~~~~~~~a~G~gs~~a~~~Le~~~~~~~~~~~~~ms~eea~~l~~~al~~~~~rd~s  210 (243)
T 1ryp_A          131 ILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFS  210 (243)
T ss_dssp             EEEEEEEETTTEEEEEEECTTSCEEEBSEEEESTTHHHHHHHHHHHHHHHCSSSCCCSSHHHHHHHHHHHHHHHHTCCCC
T ss_pred             EEEEEEEcCCCCcEEEEEcCCCCEEEEEEEEECCCcHHHHHHHHHHhhhcccccccCCCHHHHHHHHHHHHHHHhcccCC
Confidence            999999997678999999999999999999999999999999999996311     899999999999999999999954


Q ss_pred             CCeEEEEEEEeCCCcEEEcCHHHHHHHHHHhhccC
Q 029584          157 ASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  191 (191)
Q Consensus       157 ~~~iei~iv~~~~~~~~~~~~~~i~~~~~~~~~~~  191 (191)
                      ..+++|++|++++  |++++++||++++.++.++|
T Consensus       211 ~~~iev~vi~~~g--~~~l~~~ei~~~~~~~~~~~  243 (243)
T 1ryp_A          211 KNDLEVGVATKDK--FFTLSAENIEERLVAIAEQD  243 (243)
T ss_dssp             TTSEEEEEEETTE--EEECCHHHHHHHHHHHTTTC
T ss_pred             CCcEEEEEEECCC--eEECCHHHHHHHHHHhhccC
Confidence            4599999999986  99999999999999999887



>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1irua_244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 4e-60
d1rypa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 2e-48
d1irud_243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 2e-46
d1irue_234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 1e-44
d1iruf_238 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 6e-44
d1rypb_250 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 2e-43
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 2e-42
d1irug_245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 2e-42
d1rypd_241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 4e-41
d1j2pa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 5e-41
d1rype_242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 7e-41
d1iruc_250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 1e-40
d1rypf_233 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 4e-40
d1rypg_244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 8e-40
d1rypc_244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 1e-37
d1irub_233 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 3e-37
d1q5qa_227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 1e-34
d1ryp2_233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 2e-29
d1iruh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 6e-25
d1yarh1203 d.153.1.4 (H:1-203) Proteasome beta subunit (catal 3e-24
d1rypl_212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 4e-24
d1ryp1_222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 9e-24
d1irul_201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 2e-22
d1q5qh_224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 2e-22
d1j2qh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-21
d1iruj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 9e-21
d1ryph_205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 9e-20
d1irui_220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 7e-19
d1rypk_198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 9e-19
d1iruk_199 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 1e-16
d1rypj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 1e-16
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  185 bits (471), Expect = 4e-60
 Identities = 114/188 (60%), Positives = 154/188 (81%)

Query: 3   DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW 62
           DKLLD ++VTHLF IT+ +G + TGMTAD+R+ VQ+ARYEAA +++KYGYE+PVD+L K 
Sbjct: 57  DKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKR 116

Query: 63  IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN 122
           IAD SQVYTQ+A MRPLG   +++ IDEE GP+++KCDPAG++ G KAT+AG+K+ E+ +
Sbjct: 117 IADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTS 176

Query: 123 FLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDE 182
           FLEKK+K    +TF++TV+TAI+ L +VL  DFK SEIEVGVV+ ENP+FR+L+  EID 
Sbjct: 177 FLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDA 236

Query: 183 HLTAISER 190
           HL A++ER
Sbjct: 237 HLVALAER 244


>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1irua_244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypa_243 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1iruc_250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1j2pa_243 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 100.0
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rype_242 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irug_245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1iruf_238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypb_250 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irud_243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypd_241 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1rypc_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1yarh1203 Proteasome beta subunit (catalytic) {Archaeon Ther 100.0
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 100.0
d1rypg_244 Proteasome alpha subunit (non-catalytic) {Baker's 100.0
d1irul_201 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 100.0
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1rypl_212 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iruh_202 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1q5qa_227 Proteasome alpha subunit (non-catalytic) {Rhodococ 100.0
d1ryp2_233 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1irui_220 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1iru2_217 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypi_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1q5qh_224 Proteasome beta subunit (catalytic) {Rhodococcus e 100.0
d1ryp1_222 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 100.0
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1iru1_213 Proteasome beta subunit (catalytic) {Cow (Bos taur 100.0
d1m4ya_171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 99.72
d2z3ba1180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 99.67
d1g3ka_173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 99.66
d1cuka148 DNA helicase RuvA subunit, C-terminal domain {Esch 83.17
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome alpha subunit (non-catalytic)
species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00  E-value=5.6e-48  Score=306.56  Aligned_cols=189  Identities=60%  Similarity=0.964  Sum_probs=181.5

Q ss_pred             CCccccCCCCcceEEecCcEEEEEecchHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhhcCcccccc
Q 029584            2 QDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGV   81 (191)
Q Consensus         2 ~s~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~t~~~~~rP~~v   81 (191)
                      +++++.+++++|||+|++|++|++||+.+|++.+.+.+|.+++.|++.++++++++.+++.+++++|.||+++++|||+|
T Consensus        56 ~~~~~~~~~~~KI~~I~~~i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~~~~~t~~~~~rP~~v  135 (244)
T d1irua_          56 PDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGC  135 (244)
T ss_dssp             CCSSBCGGGCCSEEESSSSCEEEEEECHHHHHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHHHHBSSBCCCSE
T ss_pred             ccccccCCccceEEEecCCcEEEEecchHHHHHHHHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHHHHhcccccCccce
Confidence            46777788999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEEEEEcCCCCCeEEEECCCcceeceeeeecCCChHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHhhhcccCCCCeEE
Q 029584           82 VAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIE  161 (191)
Q Consensus        82 ~~iv~G~d~~~~p~Ly~~d~~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~~~s~eea~~l~~~~l~~~~~~d~~~~~ie  161 (191)
                      ++||+|||+++||+||.+||+|++.+++++|+|+|++.++++||++|.+.++||++||++++++||+.+.++|..+++++
T Consensus       136 ~~ll~G~D~~~g~~Ly~~Dp~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~d~t~eeai~l~~~~l~~~~~~d~~~~~ie  215 (244)
T d1irua_         136 CMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIE  215 (244)
T ss_dssp             EEEEEEEETTTEEEEEEECTTSCEEEBSEEEEETTHHHHHHHHHHHTTSCCCCCHHHHHHHHHHHHHHHTTCCCCTTSEE
T ss_pred             eeEEEEEcCCCCcEEEEEcCCccEEecceEeccCchhHHHHHHHhccccccCCCHHHHHHHHHHHHHHHHhcCCCCCcEE
Confidence            99999999867899999999999999999999999999999999999767899999999999999999999998888999


Q ss_pred             EEEEEeCCCcEEEcCHHHHHHHHHHhhcc
Q 029584          162 VGVVSKENPEFRVLSIEEIDEHLTAISER  190 (191)
Q Consensus       162 i~iv~~~~~~~~~~~~~~i~~~~~~~~~~  190 (191)
                      |+|+++++++|++++++||+++|.++++|
T Consensus       216 v~ii~~~~~~~~~l~~~ei~~~l~~~~~r  244 (244)
T d1irua_         216 VGVVTVENPKFRILTEAEIDAHLVALAER  244 (244)
T ss_dssp             EEEEETTEEEEEECCHHHHHHHHHHHHTC
T ss_pred             EEEEEeCCCcEEECCHHHHHHHHHHHhcC
Confidence            99999998789999999999999999886



>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure