Citrus Sinensis ID: 029584
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| 255583952 | 246 | proteasome subunit alpha type, putative | 0.989 | 0.768 | 0.925 | 2e-99 | |
| 356545355 | 368 | PREDICTED: proteasome subunit alpha type | 0.989 | 0.513 | 0.904 | 5e-98 | |
| 217075112 | 246 | unknown [Medicago truncatula] gi|3885172 | 0.989 | 0.768 | 0.883 | 5e-97 | |
| 12229948 | 246 | RecName: Full=Proteasome subunit alpha t | 0.989 | 0.768 | 0.904 | 6e-97 | |
| 351721962 | 246 | proteasome subunit alpha type-6 [Glycine | 0.989 | 0.768 | 0.894 | 6e-97 | |
| 211906468 | 246 | 20S proteasome subunit alpha-1 [Gossypiu | 0.989 | 0.768 | 0.894 | 3e-96 | |
| 255648341 | 246 | unknown [Glycine max] | 0.989 | 0.768 | 0.894 | 4e-96 | |
| 225442079 | 246 | PREDICTED: proteasome subunit alpha type | 0.989 | 0.768 | 0.888 | 7e-96 | |
| 449447912 | 246 | PREDICTED: proteasome subunit alpha type | 0.989 | 0.768 | 0.894 | 7e-96 | |
| 388519097 | 246 | unknown [Lotus japonicus] | 0.989 | 0.768 | 0.883 | 4e-95 |
| >gi|255583952|ref|XP_002532723.1| proteasome subunit alpha type, putative [Ricinus communis] gi|223527531|gb|EEF29654.1| proteasome subunit alpha type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 366 bits (940), Expect = 2e-99, Method: Compositional matrix adjust.
Identities = 175/189 (92%), Positives = 181/189 (95%)
Query: 3 DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW 62
DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQAR EAAEFRFKYGYEMPVDVLAKW
Sbjct: 58 DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLAKW 117
Query: 63 IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN 122
IADKSQ+YTQHAYMRPLGVVAMVL ID+E GPRL+KCDPAGHFFGHKATSAGLKEQEAIN
Sbjct: 118 IADKSQIYTQHAYMRPLGVVAMVLGIDDEYGPRLYKCDPAGHFFGHKATSAGLKEQEAIN 177
Query: 123 FLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDE 182
FLEKKMKNDPAFT++ETVQTAIS LQSVLQEDFKA+EIEVGVV ENP FRVLS EEIDE
Sbjct: 178 FLEKKMKNDPAFTYEETVQTAISALQSVLQEDFKATEIEVGVVRTENPVFRVLSTEEIDE 237
Query: 183 HLTAISERD 191
HLTAISERD
Sbjct: 238 HLTAISERD 246
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356545355|ref|XP_003541109.1| PREDICTED: proteasome subunit alpha type-6-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|217075112|gb|ACJ85916.1| unknown [Medicago truncatula] gi|388517215|gb|AFK46669.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|12229948|sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S proteasome alpha subunit A; AltName: Full=20S proteasome subunit alpha-1 gi|4539545|emb|CAB39975.1| PRCI [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|351721962|ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max] gi|12229897|sp|O48551.2|PSA6_SOYBN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S proteasome alpha subunit A; AltName: Full=20S proteasome subunit alpha-1; AltName: Full=Proteasome iota subunit gi|3377794|gb|AAC28135.1| proteasome IOTA subunit [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|211906468|gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|255648341|gb|ACU24622.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225442079|ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Vitis vinifera] gi|147797489|emb|CAN73517.1| hypothetical protein VITISV_005460 [Vitis vinifera] gi|297742984|emb|CBI35851.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449447912|ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus] gi|449480500|ref|XP_004155912.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388519097|gb|AFK47610.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| TAIR|locus:2157106 | 246 | PAA1 "proteasome alpha subunit | 0.989 | 0.768 | 0.835 | 1.9e-83 | |
| TAIR|locus:2064727 | 246 | PAA2 "20S proteasome subunit P | 0.989 | 0.768 | 0.835 | 2.8e-82 | |
| UNIPROTKB|E2RMN2 | 246 | PSMA6 "Proteasome subunit alph | 0.989 | 0.768 | 0.613 | 7.3e-59 | |
| UNIPROTKB|Q2YDE4 | 246 | PSMA6 "Proteasome subunit alph | 0.989 | 0.768 | 0.608 | 1.5e-58 | |
| UNIPROTKB|B4DXJ9 | 227 | PSMA6 "cDNA FLJ51729, highly s | 0.989 | 0.832 | 0.608 | 1.5e-58 | |
| UNIPROTKB|P60900 | 246 | PSMA6 "Proteasome subunit alph | 0.989 | 0.768 | 0.608 | 1.5e-58 | |
| UNIPROTKB|F2Z5N0 | 246 | PSMA6 "Proteasome subunit alph | 0.989 | 0.768 | 0.608 | 1.5e-58 | |
| MGI|MGI:1347006 | 246 | Psma6 "proteasome (prosome, ma | 0.989 | 0.768 | 0.608 | 1.5e-58 | |
| RGD|61849 | 246 | Psma6 "proteasome (prosome, ma | 0.989 | 0.768 | 0.608 | 1.5e-58 | |
| ZFIN|ZDB-GENE-020326-1 | 246 | psma6a "proteasome (prosome, m | 0.989 | 0.768 | 0.603 | 3.2e-58 |
| TAIR|locus:2157106 PAA1 "proteasome alpha subunit A1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 836 (299.3 bits), Expect = 1.9e-83, P = 1.9e-83
Identities = 158/189 (83%), Positives = 176/189 (93%)
Query: 3 DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW 62
DKLLD +SVTHLFPITKY+GL+ATG+TADAR+LVQQAR +AAEFRF YGYEMPVD+LAKW
Sbjct: 58 DKLLDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKW 117
Query: 63 IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN 122
IADKSQVYTQHAYMRPLGVVAMV+ +DEE GP L+KCDPAGHF+GHKATSAG+KEQEA+N
Sbjct: 118 IADKSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVN 177
Query: 123 FLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDE 182
FLEKKMK +P+FTF ETVQTAIS LQSVLQEDFKA+EIEVGVV ENPEFR L+ EEI+E
Sbjct: 178 FLEKKMKENPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEE 237
Query: 183 HLTAISERD 191
HLTAISERD
Sbjct: 238 HLTAISERD 246
|
|
| TAIR|locus:2064727 PAA2 "20S proteasome subunit PAA2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMN2 PSMA6 "Proteasome subunit alpha type" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2YDE4 PSMA6 "Proteasome subunit alpha type-6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DXJ9 PSMA6 "cDNA FLJ51729, highly similar to Proteasome subunit alpha type 6 (EC 3.4.25.1)" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P60900 PSMA6 "Proteasome subunit alpha type-6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z5N0 PSMA6 "Proteasome subunit alpha type" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1347006 Psma6 "proteasome (prosome, macropain) subunit, alpha type 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|61849 Psma6 "proteasome (prosome, macropain) subunit, alpha type 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020326-1 psma6a "proteasome (prosome, macropain) subunit, alpha type, 6a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034058001 | RecName- Full=Proteasome subunit alpha type; EC=3.4.25.1;; The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) (246 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00015420001 | • | • | • | • | • | 0.945 | |||||
| GSVIVG00024499001 | • | • | • | • | • | 0.945 | |||||
| GSVIVG00014791001 | • | • | • | • | 0.932 | ||||||
| GSVIVG00023752001 | • | • | • | • | • | 0.926 | |||||
| GSVIVG00010470001 | • | • | • | 0.911 | |||||||
| GSVIVG00026350001 | • | • | • | • | • | 0.901 | |||||
| GSVIVG00030725001 | • | • | • | • | • | 0.899 | |||||
| GSVIVG00035048001 | • | • | • | • | 0.879 | ||||||
| GSVIVG00036762001 | • | • | • | • | 0.845 | ||||||
| GSVIVG00006696001 | • | • | • | • | 0.798 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| cd03754 | 215 | cd03754, proteasome_alpha_type_6, proteasome_alpha | 1e-103 | |
| cd01911 | 209 | cd01911, proteasome_alpha, proteasome alpha subuni | 4e-82 | |
| cd01906 | 182 | cd01906, proteasome_protease_HslV, proteasome_prot | 2e-48 | |
| pfam00227 | 188 | pfam00227, Proteasome, Proteasome subunit | 6e-47 | |
| PRK03996 | 241 | PRK03996, PRK03996, proteasome subunit alpha; Prov | 2e-45 | |
| TIGR03633 | 224 | TIGR03633, arc_protsome_A, proteasome endopeptidas | 2e-42 | |
| COG0638 | 236 | COG0638, PRE1, 20S proteasome, alpha and beta subu | 1e-39 | |
| cd03750 | 227 | cd03750, proteasome_alpha_type_2, proteasome_alpha | 3e-39 | |
| cd03756 | 211 | cd03756, proteasome_alpha_archeal, proteasome_alph | 7e-37 | |
| cd03749 | 211 | cd03749, proteasome_alpha_type_1, proteasome_alpha | 1e-30 | |
| PTZ00246 | 253 | PTZ00246, PTZ00246, proteasome subunit alpha; Prov | 6e-28 | |
| cd01901 | 164 | cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term | 2e-27 | |
| cd03752 | 213 | cd03752, proteasome_alpha_type_4, proteasome_alpha | 6e-27 | |
| cd03755 | 207 | cd03755, proteasome_alpha_type_7, proteasome_alpha | 8e-25 | |
| cd03751 | 212 | cd03751, proteasome_alpha_type_3, proteasome_alpha | 1e-24 | |
| cd03753 | 213 | cd03753, proteasome_alpha_type_5, proteasome_alpha | 6e-24 | |
| cd03764 | 188 | cd03764, proteasome_beta_archeal, Archeal proteaso | 3e-11 | |
| TIGR03634 | 185 | TIGR03634, arc_protsome_B, proteasome endopeptidas | 3e-10 | |
| cd01912 | 189 | cd01912, proteasome_beta, proteasome beta subunit | 3e-09 | |
| cd03757 | 212 | cd03757, proteasome_beta_type_1, proteasome beta t | 0.001 |
| >gnl|CDD|239723 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6 | Back alignment and domain information |
|---|
Score = 296 bits (759), Expect = e-103
Identities = 112/167 (67%), Positives = 140/167 (83%), Gaps = 2/167 (1%)
Query: 1 MQDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLA 60
+ DKL+D ++VTHLF IT +G + TGM AD+R+ VQ+ARYEAAEF++KYGYEMPVDVLA
Sbjct: 49 VPDKLIDPSTVTHLFRITDEIGCVMTGMIADSRSQVQRARYEAAEFKYKYGYEMPVDVLA 108
Query: 61 KWIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEA 120
K IAD +QVYTQHAYMRPLGV +++ IDEE GP+L+KCDPAG+F G+KAT+AG+KEQEA
Sbjct: 109 KRIADINQVYTQHAYMRPLGVSMILIGIDEELGPQLYKCDPAGYFAGYKATAAGVKEQEA 168
Query: 121 INFLEKKMKNDPAF--TFQETVQTAISTLQSVLQEDFKASEIEVGVV 165
NFLEKK+K P +++ETV+ AIS LQ+VL DFKA+EIEVGVV
Sbjct: 169 TNFLEKKLKKKPDLIESYEETVELAISCLQTVLSTDFKATEIEVGVV 215
|
The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 215 |
| >gnl|CDD|238892 cd01911, proteasome_alpha, proteasome alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV | Back alignment and domain information |
|---|
| >gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235192 PRK03996, PRK03996, proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239719 cd03750, proteasome_alpha_type_2, proteasome_alpha_type_2 | Back alignment and domain information |
|---|
| >gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >gnl|CDD|239718 cd03749, proteasome_alpha_type_1, proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >gnl|CDD|173491 PTZ00246, PTZ00246, proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >gnl|CDD|239721 cd03752, proteasome_alpha_type_4, proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >gnl|CDD|239724 cd03755, proteasome_alpha_type_7, proteasome_alpha_type_7 | Back alignment and domain information |
|---|
| >gnl|CDD|239720 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >gnl|CDD|239722 cd03753, proteasome_alpha_type_5, proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239726 cd03757, proteasome_beta_type_1, proteasome beta type-1 subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| cd03750 | 227 | proteasome_alpha_type_2 proteasome_alpha_type_2. T | 100.0 | |
| KOG0176 | 241 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| KOG0182 | 246 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| PRK03996 | 241 | proteasome subunit alpha; Provisional | 100.0 | |
| PTZ00246 | 253 | proteasome subunit alpha; Provisional | 100.0 | |
| COG0638 | 236 | PRE1 20S proteasome, alpha and beta subunits [Post | 100.0 | |
| KOG0181 | 233 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| TIGR03690 | 219 | 20S_bact_beta proteasome, beta subunit, bacterial | 100.0 | |
| cd03758 | 193 | proteasome_beta_type_2 proteasome beta type-2 subu | 100.0 | |
| KOG0183 | 249 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| cd03760 | 197 | proteasome_beta_type_4 proteasome beta type-4 subu | 100.0 | |
| cd03754 | 215 | proteasome_alpha_type_6 proteasome_alpha_type_6. T | 100.0 | |
| TIGR03633 | 224 | arc_protsome_A proteasome endopeptidase complex, a | 100.0 | |
| PTZ00488 | 247 | Proteasome subunit beta type-5; Provisional | 100.0 | |
| cd03759 | 195 | proteasome_beta_type_3 proteasome beta type-3 subu | 100.0 | |
| cd03761 | 188 | proteasome_beta_type_5 proteasome beta type-5 subu | 100.0 | |
| cd03755 | 207 | proteasome_alpha_type_7 proteasome_alpha_type_7. T | 100.0 | |
| cd03749 | 211 | proteasome_alpha_type_1 proteasome_alpha_type_1. T | 100.0 | |
| cd03751 | 212 | proteasome_alpha_type_3 proteasome_alpha_type_3. T | 100.0 | |
| KOG0178 | 249 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| cd03752 | 213 | proteasome_alpha_type_4 proteasome_alpha_type_4. T | 100.0 | |
| KOG0863 | 264 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| TIGR03691 | 228 | 20S_bact_alpha proteasome, alpha subunit, bacteria | 100.0 | |
| cd03756 | 211 | proteasome_alpha_archeal proteasome_alpha_archeal. | 100.0 | |
| cd03757 | 212 | proteasome_beta_type_1 proteasome beta type-1 subu | 100.0 | |
| TIGR03634 | 185 | arc_protsome_B proteasome endopeptidase complex, a | 100.0 | |
| cd03765 | 236 | proteasome_beta_bacterial Bacterial proteasome, be | 100.0 | |
| cd03764 | 188 | proteasome_beta_archeal Archeal proteasome, beta s | 100.0 | |
| cd03763 | 189 | proteasome_beta_type_7 proteasome beta type-7 subu | 100.0 | |
| cd03762 | 188 | proteasome_beta_type_6 proteasome beta type-6 subu | 100.0 | |
| cd01911 | 209 | proteasome_alpha proteasome alpha subunit. The 20S | 100.0 | |
| cd03753 | 213 | proteasome_alpha_type_5 proteasome_alpha_type_5. T | 100.0 | |
| PF00227 | 190 | Proteasome: Proteasome subunit; InterPro: IPR00135 | 100.0 | |
| cd01912 | 189 | proteasome_beta proteasome beta subunit. The 20S p | 100.0 | |
| KOG0184 | 254 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| cd01906 | 182 | proteasome_protease_HslV proteasome_protease_HslV. | 100.0 | |
| KOG0175 | 285 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0177 | 200 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0179 | 235 | consensus 20S proteasome, regulatory subunit beta | 99.98 | |
| KOG0185 | 256 | consensus 20S proteasome, regulatory subunit beta | 99.96 | |
| KOG0174 | 224 | consensus 20S proteasome, regulatory subunit beta | 99.96 | |
| KOG0173 | 271 | consensus 20S proteasome, regulatory subunit beta | 99.95 | |
| KOG0180 | 204 | consensus 20S proteasome, regulatory subunit beta | 99.94 | |
| cd01901 | 164 | Ntn_hydrolase The Ntn hydrolases (N-terminal nucle | 99.94 | |
| PRK05456 | 172 | ATP-dependent protease subunit HslV; Provisional | 99.93 | |
| cd01913 | 171 | protease_HslV Protease HslV and the ATPase/chapero | 99.93 | |
| TIGR03692 | 171 | ATP_dep_HslV ATP-dependent protease HslVU, peptida | 99.92 | |
| COG5405 | 178 | HslV ATP-dependent protease HslVU (ClpYQ), peptida | 99.01 | |
| COG3484 | 255 | Predicted proteasome-type protease [Posttranslatio | 97.42 | |
| KOG3361 | 157 | consensus Iron binding protein involved in Fe-S cl | 87.39 |
| >cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-44 Score=286.16 Aligned_cols=179 Identities=35% Similarity=0.583 Sum_probs=170.9
Q ss_pred CCccccCCCCcceEEecCcEEEEEecchHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhhcCcccccc
Q 029584 2 QDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGV 81 (191)
Q Consensus 2 ~s~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~t~~~~~rP~~v 81 (191)
.++|+.+++.+||++|++|++|++||+.+|++.+.+++|.+++.|++++|++++++.++++|++.+|+|+++++.|||+|
T Consensus 48 ~~~l~~~~~~~KI~~I~~~i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~~~~~t~~~~~rP~~v 127 (227)
T cd03750 48 PSPLIDESSVHKVEQITPHIGMVYSGMGPDFRVLVKKARKIAQQYYLVYGEPIPVSQLVREIASVMQEYTQSGGVRPFGV 127 (227)
T ss_pred CccccCCCCcceEEEEcCCEEEEEeEcHHhHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCCCCCCChhe
Confidence 36788889999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeEEEEEcCCCCCeEEEECCCcceeceeeeecCCChHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHhhhcccCCCCeEE
Q 029584 82 VAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIE 161 (191)
Q Consensus 82 ~~iv~G~d~~~~p~Ly~~d~~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~~~s~eea~~l~~~~l~~~~~~d~~~~~ie 161 (191)
++||+|||+ .||+||.+||+|++.+++++|+|+|++.++++||++|+ ++||++||++++++||+.+.+|++...+++
T Consensus 128 ~~li~G~D~-~g~~Ly~~d~~G~~~~~~~~a~G~g~~~~~~~Le~~~~--~~ms~eeai~l~~~~l~~~~~~~l~~~~ie 204 (227)
T cd03750 128 SLLIAGWDE-GGPYLYQVDPSGSYFTWKATAIGKNYSNAKTFLEKRYN--EDLELEDAIHTAILTLKEGFEGQMTEKNIE 204 (227)
T ss_pred EEEEEEEeC-CCCEEEEECCCCCEEeeeEEEECCCCHHHHHHHHhhcc--CCCCHHHHHHHHHHHHHHHhcccCCCCcEE
Confidence 999999997 68999999999999999999999999999999999984 789999999999999999999888777999
Q ss_pred EEEEEeCCCcEEEcCHHHHHHHH
Q 029584 162 VGVVSKENPEFRVLSIEEIDEHL 184 (191)
Q Consensus 162 i~iv~~~~~~~~~~~~~~i~~~~ 184 (191)
|+++++++ ++++++++||++++
T Consensus 205 v~iv~~~~-~~~~~~~~ei~~~~ 226 (227)
T cd03750 205 IGICGETK-GFRLLTPAEIKDYL 226 (227)
T ss_pred EEEEECCC-CEEECCHHHHHHHh
Confidence 99999874 49999999999986
|
The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. |
| >KOG0176 consensus 20S proteasome, regulatory subunit alpha type PSMA5/PUP2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0182 consensus 20S proteasome, regulatory subunit alpha type PSMA6/SCL1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03996 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PTZ00246 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0181 consensus 20S proteasome, regulatory subunit alpha type PSMA2/PRE8 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type | Back alignment and domain information |
|---|
| >cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit | Back alignment and domain information |
|---|
| >KOG0183 consensus 20S proteasome, regulatory subunit alpha type PSMA7/PRE6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit | Back alignment and domain information |
|---|
| >cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 | Back alignment and domain information |
|---|
| >TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >PTZ00488 Proteasome subunit beta type-5; Provisional | Back alignment and domain information |
|---|
| >cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit | Back alignment and domain information |
|---|
| >cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit | Back alignment and domain information |
|---|
| >cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 | Back alignment and domain information |
|---|
| >cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >KOG0178 consensus 20S proteasome, regulatory subunit alpha type PSMA4/PRE9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >KOG0863 consensus 20S proteasome, regulatory subunit alpha type PSMA1/PRE5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type | Back alignment and domain information |
|---|
| >cd03756 proteasome_alpha_archeal proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit | Back alignment and domain information |
|---|
| >TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit | Back alignment and domain information |
|---|
| >cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit | Back alignment and domain information |
|---|
| >cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit | Back alignment and domain information |
|---|
| >cd01911 proteasome_alpha proteasome alpha subunit | Back alignment and domain information |
|---|
| >cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins | Back alignment and domain information |
|---|
| >cd01912 proteasome_beta proteasome beta subunit | Back alignment and domain information |
|---|
| >KOG0184 consensus 20S proteasome, regulatory subunit alpha type PSMA3/PRE10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01906 proteasome_protease_HslV proteasome_protease_HslV | Back alignment and domain information |
|---|
| >KOG0175 consensus 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0177 consensus 20S proteasome, regulatory subunit beta type PSMB2/PRE1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0179 consensus 20S proteasome, regulatory subunit beta type PSMB1/PRE7 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0185 consensus 20S proteasome, regulatory subunit beta type PSMB4/PRE4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0174 consensus 20S proteasome, regulatory subunit beta type PSMB6/PSMB9/PRE3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0173 consensus 20S proteasome, regulatory subunit beta type PSMB7/PSMB10/PUP1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0180 consensus 20S proteasome, regulatory subunit beta type PSMB3/PUP3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >PRK05456 ATP-dependent protease subunit HslV; Provisional | Back alignment and domain information |
|---|
| >cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome | Back alignment and domain information |
|---|
| >TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit | Back alignment and domain information |
|---|
| >COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3361 consensus Iron binding protein involved in Fe-S cluster formation [Energy production and conversion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 191 | ||||
| 3unb_G | 246 | Mouse Constitutive 20s Proteasome In Complex With P | 2e-66 | ||
| 1iru_A | 246 | Crystal Structure Of The Mammalian 20s Proteasome A | 2e-66 | ||
| 1g0u_G | 252 | A Gated Channel Into The Proteasome Core Particle L | 7e-43 | ||
| 1ryp_A | 243 | Crystal Structure Of The 20s Proteasome From Yeast | 7e-43 | ||
| 3h4p_A | 264 | Proteasome 20s Core Particle From Methanocaldococcu | 2e-26 | ||
| 1iru_B | 233 | Crystal Structure Of The Mammalian 20s Proteasome A | 1e-23 | ||
| 3jrm_A | 227 | Crystal Structure Of Archaeal 20s Proteasome In Com | 1e-23 | ||
| 3unb_A | 234 | Mouse Constitutive 20s Proteasome In Complex With P | 1e-23 | ||
| 1yau_A | 233 | Structure Of Archeabacterial 20s Proteasome- Pa26 C | 1e-23 | ||
| 2ku1_A | 237 | Dynamic Regulation Of Archaeal Proteasome Gate Open | 1e-23 | ||
| 1yar_A | 233 | Structure Of Archeabacterial 20s Proteasome Mutant | 1e-23 | ||
| 2ku2_A | 237 | Dynamic Regulation Of Archaeal Proteasome Gate Open | 1e-23 | ||
| 1pma_A | 233 | Proteasome From Thermoplasma Acidophilum Length = 2 | 1e-23 | ||
| 1j2q_A | 237 | 20s Proteasome In Complex With Calpain-inhibitor I | 1e-22 | ||
| 1j2p_A | 246 | Alpha-Ring From The Proteasome From Archaeoglobus F | 3e-22 | ||
| 3unb_C | 248 | Mouse Constitutive 20s Proteasome In Complex With P | 2e-20 | ||
| 3une_C | 248 | Mouse Constitutive 20s Proteasome Length = 248 | 2e-20 | ||
| 1iru_D | 248 | Crystal Structure Of The Mammalian 20s Proteasome A | 6e-19 | ||
| 1iru_F | 263 | Crystal Structure Of The Mammalian 20s Proteasome A | 7e-19 | ||
| 3unb_E | 263 | Mouse Constitutive 20s Proteasome In Complex With P | 8e-19 | ||
| 1ryp_B | 250 | Crystal Structure Of The 20s Proteasome From Yeast | 4e-18 | ||
| 1vsy_B | 231 | Proteasome Activator Complex Length = 231 | 4e-18 | ||
| 1vsy_D | 227 | Proteasome Activator Complex Length = 227 | 1e-17 | ||
| 1ryp_D | 241 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-17 | ||
| 1g0u_C | 243 | A Gated Channel Into The Proteasome Core Particle L | 1e-17 | ||
| 1fnt_D | 254 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-17 | ||
| 1vsy_C | 232 | Proteasome Activator Complex Length = 232 | 2e-17 | ||
| 1g0u_B | 245 | A Gated Channel Into The Proteasome Core Particle L | 2e-17 | ||
| 1ryp_C | 244 | Crystal Structure Of The 20s Proteasome From Yeast | 3e-17 | ||
| 3oeu_B | 235 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 3e-17 | ||
| 1z7q_C | 258 | Crystal Structure Of The 20s Proteasome From Yeast | 3e-17 | ||
| 1iru_C | 261 | Crystal Structure Of The Mammalian 20s Proteasome A | 5e-16 | ||
| 3unb_F | 255 | Mouse Constitutive 20s Proteasome In Complex With P | 6e-16 | ||
| 1iru_G | 254 | Crystal Structure Of The Mammalian 20s Proteasome A | 8e-16 | ||
| 1iru_E | 241 | Crystal Structure Of The Mammalian 20s Proteasome A | 2e-15 | ||
| 3unb_D | 241 | Mouse Constitutive 20s Proteasome In Complex With P | 2e-15 | ||
| 3unb_B | 261 | Mouse Constitutive 20s Proteasome In Complex With P | 4e-15 | ||
| 1fnt_G | 287 | Crystal Structure Of The 20s Proteasome From Yeast | 4e-13 | ||
| 1z7q_G | 288 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-13 | ||
| 3oeu_F | 242 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 5e-13 | ||
| 1g0u_D | 241 | A Gated Channel Into The Proteasome Core Particle L | 5e-13 | ||
| 1g0u_F | 248 | A Gated Channel Into The Proteasome Core Particle L | 5e-13 | ||
| 1ryp_G | 244 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-13 | ||
| 1vsy_E | 250 | Proteasome Activator Complex Length = 250 | 1e-12 | ||
| 4g4s_E | 261 | Structure Of Proteasome-Pba1-Pba2 Complex Length = | 2e-12 | ||
| 1fnt_E | 260 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-12 | ||
| 2z5c_C | 262 | Crystal Structure Of A Novel Chaperone Complex For | 2e-12 | ||
| 1ryp_E | 242 | Crystal Structure Of The 20s Proteasome From Yeast | 2e-12 | ||
| 3sdi_E | 233 | Structure Of Yeast 20s Open-Gate Proteasome With Co | 1e-09 | ||
| 1g0u_E | 234 | A Gated Channel Into The Proteasome Core Particle L | 1e-09 | ||
| 1ryp_F | 233 | Crystal Structure Of The 20s Proteasome From Yeast | 7e-09 | ||
| 1fnt_F | 234 | Crystal Structure Of The 20s Proteasome From Yeast | 8e-09 | ||
| 4g4s_F | 235 | Structure Of Proteasome-Pba1-Pba2 Complex Length = | 8e-09 | ||
| 3c91_H | 203 | Thermoplasma Acidophilum 20s Proteasome With An Ope | 2e-06 | ||
| 1ya7_H | 217 | Implications For Interactions Of Proteasome With Pa | 2e-06 | ||
| 1pma_B | 211 | Proteasome From Thermoplasma Acidophilum Length = 2 | 2e-06 |
| >pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 246 | Back alignment and structure |
|
| >pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 246 | Back alignment and structure |
| >pdb|1G0U|G Chain G, A Gated Channel Into The Proteasome Core Particle Length = 252 | Back alignment and structure |
| >pdb|1RYP|A Chain A, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 243 | Back alignment and structure |
| >pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 | Back alignment and structure |
| >pdb|1IRU|B Chain B, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 233 | Back alignment and structure |
| >pdb|3JRM|A Chain A, Crystal Structure Of Archaeal 20s Proteasome In Complex With Mutated P26 Activator Length = 227 | Back alignment and structure |
| >pdb|3UNB|A Chain A, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 | Back alignment and structure |
| >pdb|1YAU|A Chain A, Structure Of Archeabacterial 20s Proteasome- Pa26 Complex Length = 233 | Back alignment and structure |
| >pdb|2KU1|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 | Back alignment and structure |
| >pdb|1YAR|A Chain A, Structure Of Archeabacterial 20s Proteasome Mutant D9s- Pa26 Complex Length = 233 | Back alignment and structure |
| >pdb|2KU2|A Chain A, Dynamic Regulation Of Archaeal Proteasome Gate Opening As Studied By Trosy-Nmr Length = 237 | Back alignment and structure |
| >pdb|1PMA|A Chain A, Proteasome From Thermoplasma Acidophilum Length = 233 | Back alignment and structure |
| >pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 | Back alignment and structure |
| >pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome From Archaeoglobus Fulgidus Length = 246 | Back alignment and structure |
| >pdb|3UNB|C Chain C, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 248 | Back alignment and structure |
| >pdb|3UNE|C Chain C, Mouse Constitutive 20s Proteasome Length = 248 | Back alignment and structure |
| >pdb|1IRU|D Chain D, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 248 | Back alignment and structure |
| >pdb|1IRU|F Chain F, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 263 | Back alignment and structure |
| >pdb|3UNB|E Chain E, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 263 | Back alignment and structure |
| >pdb|1RYP|B Chain B, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 250 | Back alignment and structure |
| >pdb|1VSY|B Chain B, Proteasome Activator Complex Length = 231 | Back alignment and structure |
| >pdb|1VSY|D Chain D, Proteasome Activator Complex Length = 227 | Back alignment and structure |
| >pdb|1RYP|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 241 | Back alignment and structure |
| >pdb|1G0U|C Chain C, A Gated Channel Into The Proteasome Core Particle Length = 243 | Back alignment and structure |
| >pdb|1FNT|D Chain D, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 254 | Back alignment and structure |
| >pdb|1VSY|C Chain C, Proteasome Activator Complex Length = 232 | Back alignment and structure |
| >pdb|1G0U|B Chain B, A Gated Channel Into The Proteasome Core Particle Length = 245 | Back alignment and structure |
| >pdb|1RYP|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 | Back alignment and structure |
| >pdb|3OEU|B Chain B, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 235 | Back alignment and structure |
| >pdb|1Z7Q|C Chain C, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 258 | Back alignment and structure |
| >pdb|1IRU|C Chain C, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 261 | Back alignment and structure |
| >pdb|3UNB|F Chain F, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 255 | Back alignment and structure |
| >pdb|1IRU|G Chain G, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 254 | Back alignment and structure |
| >pdb|1IRU|E Chain E, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 241 | Back alignment and structure |
| >pdb|3UNB|D Chain D, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 241 | Back alignment and structure |
| >pdb|3UNB|B Chain B, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 261 | Back alignment and structure |
| >pdb|1FNT|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 287 | Back alignment and structure |
| >pdb|1Z7Q|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 288 | Back alignment and structure |
| >pdb|3OEU|F Chain F, Structure Of Yeast 20s Open-Gate Proteasome With Compound 24 Length = 242 | Back alignment and structure |
| >pdb|1G0U|D Chain D, A Gated Channel Into The Proteasome Core Particle Length = 241 | Back alignment and structure |
| >pdb|1G0U|F Chain F, A Gated Channel Into The Proteasome Core Particle Length = 248 | Back alignment and structure |
| >pdb|1RYP|G Chain G, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 244 | Back alignment and structure |
| >pdb|1VSY|E Chain E, Proteasome Activator Complex Length = 250 | Back alignment and structure |
| >pdb|4G4S|E Chain E, Structure Of Proteasome-Pba1-Pba2 Complex Length = 261 | Back alignment and structure |
| >pdb|1FNT|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 260 | Back alignment and structure |
| >pdb|2Z5C|C Chain C, Crystal Structure Of A Novel Chaperone Complex For Yeast 20s Proteasome Assembly Length = 262 | Back alignment and structure |
| >pdb|1RYP|E Chain E, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 242 | Back alignment and structure |
| >pdb|3SDI|E Chain E, Structure Of Yeast 20s Open-Gate Proteasome With Compound 20 Length = 233 | Back alignment and structure |
| >pdb|1G0U|E Chain E, A Gated Channel Into The Proteasome Core Particle Length = 234 | Back alignment and structure |
| >pdb|1RYP|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 | Back alignment and structure |
| >pdb|1FNT|F Chain F, Crystal Structure Of The 20s Proteasome From Yeast In Complex With The Proteasome Activator Pa26 From Trypanosome Brucei At 3.2 Angstroms Resolution Length = 234 | Back alignment and structure |
| >pdb|4G4S|F Chain F, Structure Of Proteasome-Pba1-Pba2 Complex Length = 235 | Back alignment and structure |
| >pdb|3C91|H Chain H, Thermoplasma Acidophilum 20s Proteasome With An Open Gate Length = 203 | Back alignment and structure |
| >pdb|1YA7|H Chain H, Implications For Interactions Of Proteasome With Pan And Pa700 From The 1.9 A Structure Of A Proteasome-11s Activator Complex Length = 217 | Back alignment and structure |
| >pdb|1PMA|B Chain B, Proteasome From Thermoplasma Acidophilum Length = 211 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 5e-92 | |
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 1e-87 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 1e-84 | |
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 3e-84 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 3e-83 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 8e-83 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 1e-82 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 3e-82 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 6e-82 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 6e-80 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 7e-80 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 1e-79 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 2e-79 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 4e-79 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 4e-79 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 2e-77 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 4e-72 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 1e-71 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 8e-30 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 2e-26 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 4e-21 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 5e-20 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 3e-19 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 8e-19 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 2e-17 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 2e-15 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 4e-15 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 7e-15 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 5e-14 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 7e-13 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 1e-12 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 3e-12 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 3e-12 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 4e-12 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 1e-11 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 2e-11 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 7e-11 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 7e-11 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 7e-11 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 4e-10 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 7e-10 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 3e-09 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 4e-09 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 1e-08 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 1e-07 |
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Length = 246 | Back alignment and structure |
|---|
Score = 267 bits (686), Expect = 5e-92
Identities = 115/190 (60%), Positives = 155/190 (81%)
Query: 2 QDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAK 61
DKLLD ++VTHLF IT+ +G + TGMTAD+R+ VQ+ARYEAA +++KYGYE+PVD+L K
Sbjct: 57 PDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCK 116
Query: 62 WIADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAI 121
IAD SQVYTQ+A MRPLG +++ IDEE GP+++KCDPAG++ G KAT+AG+K+ E+
Sbjct: 117 RIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTEST 176
Query: 122 NFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEID 181
+FLEKK+K +TF++TV+TAI+ L +VL DFK SEIEVGVV+ ENP+FR+L+ EID
Sbjct: 177 SFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEID 236
Query: 182 EHLTAISERD 191
HL A++ERD
Sbjct: 237 AHLVALAERD 246
|
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Length = 243 | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 | Back alignment and structure |
|---|
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Length = 248 | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 | Back alignment and structure |
|---|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Length = 250 | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 | Back alignment and structure |
|---|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Length = 241 | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Length = 261 | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Length = 233 | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Length = 263 | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 | Back alignment and structure |
|---|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 100.0 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 100.0 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3h4p_a | 219 | Proteasome subunit beta; core particle, cytoplasm, | 100.0 | |
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 100.0 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 100.0 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 100.0 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 100.0 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 100.0 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 100.0 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 100.0 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 100.0 | |
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 100.0 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 100.0 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 100.0 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 100.0 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 100.0 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 100.0 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1m4y_A | 171 | ATP-dependent protease HSLV; N-terminal catalytic | 99.97 | |
| 2z3b_A | 180 | ATP-dependent protease HSLV; N-terminal nucleophIl | 99.97 | |
| 1g3k_A | 174 | ATP-dependent protease HSLV; hydrolase; 1.90A {Hae | 99.97 |
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=2.7e-46 Score=298.60 Aligned_cols=188 Identities=47% Similarity=0.776 Sum_probs=177.9
Q ss_pred CCccccCCCCcceEEecCcEEEEEecchHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhhcCcccccc
Q 029584 2 QDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGV 81 (191)
Q Consensus 2 ~s~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~t~~~~~rP~~v 81 (191)
+++|+.+++++||++|++|++|+++|+.+|++.+.++++.+++.|+++++++++++.+++++++++|.|++++++|||+|
T Consensus 51 ~~~l~~~~~~~Ki~~i~~~i~~~~aG~~aD~~~l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~l~~y~~~~~~rP~~v 130 (243)
T 1ryp_A 51 PDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGV 130 (243)
T ss_dssp CCTTBCGGGCCSEEECSSSCEEEEESCHHHHHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHHHHBTTSCCCSC
T ss_pred CccccCCCcCCceEEECCCEEEEEEecHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHhccCCccccce
Confidence 46888899999999999999999999999999999999999999999999999999999999999999999989999999
Q ss_pred eeEEEEEcCCCCCeEEEECCCcceeceeeeecCCChHHHHHHHHHhhcCCC-----CCCHHHHHHHHHHHHHhhhcccCC
Q 029584 82 VAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDP-----AFTFQETVQTAISTLQSVLQEDFK 156 (191)
Q Consensus 82 ~~iv~G~d~~~~p~Ly~~d~~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~-----~~s~eea~~l~~~~l~~~~~~d~~ 156 (191)
++||||||+++||+||.+||+|++.+++++|+|+|++.++++||+.|++.+ +||++||++++++||..+.+||..
T Consensus 131 ~~lvaG~D~~~gp~Ly~~dp~G~~~~~~~~a~G~gs~~a~~~Le~~~~~~~~~~~~~ms~eea~~l~~~al~~~~~rd~s 210 (243)
T 1ryp_A 131 ILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFS 210 (243)
T ss_dssp EEEEEEEETTTEEEEEEECTTSCEEEBSEEEESTTHHHHHHHHHHHHHHHCSSSCCCSSHHHHHHHHHHHHHHHHTCCCC
T ss_pred EEEEEEEcCCCCcEEEEEcCCCCEEEEEEEEECCCcHHHHHHHHHHhhhcccccccCCCHHHHHHHHHHHHHHHhcccCC
Confidence 999999997678999999999999999999999999999999999996311 899999999999999999999954
Q ss_pred CCeEEEEEEEeCCCcEEEcCHHHHHHHHHHhhccC
Q 029584 157 ASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD 191 (191)
Q Consensus 157 ~~~iei~iv~~~~~~~~~~~~~~i~~~~~~~~~~~ 191 (191)
..+++|++|++++ |++++++||++++.++.++|
T Consensus 211 ~~~iev~vi~~~g--~~~l~~~ei~~~~~~~~~~~ 243 (243)
T 1ryp_A 211 KNDLEVGVATKDK--FFTLSAENIEERLVAIAEQD 243 (243)
T ss_dssp TTSEEEEEEETTE--EEECCHHHHHHHHHHHTTTC
T ss_pred CCcEEEEEEECCC--eEECCHHHHHHHHHHhhccC
Confidence 4599999999986 99999999999999999887
|
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G | Back alignment and structure |
|---|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... | Back alignment and structure |
|---|
| >3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H | Back alignment and structure |
|---|
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J | Back alignment and structure |
|---|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H | Back alignment and structure |
|---|
| >1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A | Back alignment and structure |
|---|
| >1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 191 | ||||
| d1irua_ | 244 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 4e-60 | |
| d1rypa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 2e-48 | |
| d1irud_ | 243 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 2e-46 | |
| d1irue_ | 234 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 1e-44 | |
| d1iruf_ | 238 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 6e-44 | |
| d1rypb_ | 250 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 2e-43 | |
| d1yara1 | 221 | d.153.1.4 (A:13-233) Proteasome alpha subunit (non | 2e-42 | |
| d1irug_ | 245 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 2e-42 | |
| d1rypd_ | 241 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 4e-41 | |
| d1j2pa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 5e-41 | |
| d1rype_ | 242 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 7e-41 | |
| d1iruc_ | 250 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 1e-40 | |
| d1rypf_ | 233 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 4e-40 | |
| d1rypg_ | 244 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 8e-40 | |
| d1rypc_ | 244 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 1e-37 | |
| d1irub_ | 233 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 3e-37 | |
| d1q5qa_ | 227 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 1e-34 | |
| d1ryp2_ | 233 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 2e-29 | |
| d1iruh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 6e-25 | |
| d1yarh1 | 203 | d.153.1.4 (H:1-203) Proteasome beta subunit (catal | 3e-24 | |
| d1rypl_ | 212 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 4e-24 | |
| d1ryp1_ | 222 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 9e-24 | |
| d1irul_ | 201 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 2e-22 | |
| d1q5qh_ | 224 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 2e-22 | |
| d1j2qh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 1e-21 | |
| d1iruj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 9e-21 | |
| d1ryph_ | 205 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 9e-20 | |
| d1irui_ | 220 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 7e-19 | |
| d1rypk_ | 198 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 9e-19 | |
| d1iruk_ | 199 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 1e-16 | |
| d1rypj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 1e-16 |
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome alpha subunit (non-catalytic) species: Cow (Bos taurus) [TaxId: 9913]
Score = 185 bits (471), Expect = 4e-60
Identities = 114/188 (60%), Positives = 154/188 (81%)
Query: 3 DKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKW 62
DKLLD ++VTHLF IT+ +G + TGMTAD+R+ VQ+ARYEAA +++KYGYE+PVD+L K
Sbjct: 57 DKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKR 116
Query: 63 IADKSQVYTQHAYMRPLGVVAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAIN 122
IAD SQVYTQ+A MRPLG +++ IDEE GP+++KCDPAG++ G KAT+AG+K+ E+ +
Sbjct: 117 IADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTS 176
Query: 123 FLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDE 182
FLEKK+K +TF++TV+TAI+ L +VL DFK SEIEVGVV+ ENP+FR+L+ EID
Sbjct: 177 FLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDA 236
Query: 183 HLTAISER 190
HL A++ER
Sbjct: 237 HLVALAER 244
|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 | Back information, alignment and structure |
|---|
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| d1irua_ | 244 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypa_ | 243 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1iruc_ | 250 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1j2pa_ | 243 | Proteasome alpha subunit (non-catalytic) {Archaeon | 100.0 | |
| d1yara1 | 221 | Proteasome alpha subunit (non-catalytic) {Archaeon | 100.0 | |
| d1irue_ | 234 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rype_ | 242 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1irug_ | 245 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1iruf_ | 238 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypb_ | 250 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypf_ | 233 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1irud_ | 243 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypd_ | 241 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypc_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1yarh1 | 203 | Proteasome beta subunit (catalytic) {Archaeon Ther | 100.0 | |
| d1irub_ | 233 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypg_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1irul_ | 201 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1j2qh_ | 202 | Proteasome beta subunit (catalytic) {Archaeon Arch | 100.0 | |
| d1rypk_ | 198 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1rypl_ | 212 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1ryph_ | 205 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iruh_ | 202 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1q5qa_ | 227 | Proteasome alpha subunit (non-catalytic) {Rhodococ | 100.0 | |
| d1ryp2_ | 233 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1irui_ | 220 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1iru2_ | 217 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1rypi_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1q5qh_ | 224 | Proteasome beta subunit (catalytic) {Rhodococcus e | 100.0 | |
| d1ryp1_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iruj_ | 204 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1rypj_ | 204 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iruk_ | 199 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1iru1_ | 213 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1m4ya_ | 171 | HslV (ClpQ) protease {Thermotoga maritima [TaxId: | 99.72 | |
| d2z3ba1 | 180 | HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 | 99.67 | |
| d1g3ka_ | 173 | HslV (ClpQ) protease {Haemophilus influenzae [TaxI | 99.66 | |
| d1cuka1 | 48 | DNA helicase RuvA subunit, C-terminal domain {Esch | 83.17 |
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome alpha subunit (non-catalytic) species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=5.6e-48 Score=306.56 Aligned_cols=189 Identities=60% Similarity=0.964 Sum_probs=181.5
Q ss_pred CCccccCCCCcceEEecCcEEEEEecchHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHhhhhcCcccccc
Q 029584 2 QDKLLDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGV 81 (191)
Q Consensus 2 ~s~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~t~~~~~rP~~v 81 (191)
+++++.+++++|||+|++|++|++||+.+|++.+.+.+|.+++.|++.++++++++.+++.+++++|.||+++++|||+|
T Consensus 56 ~~~~~~~~~~~KI~~I~~~i~~~~sG~~~D~~~l~~~~r~~~~~~~~~~~~~~~v~~la~~l~~~~~~~t~~~~~rP~~v 135 (244)
T d1irua_ 56 PDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGC 135 (244)
T ss_dssp CCSSBCGGGCCSEEESSSSCEEEEEECHHHHHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHHHHBSSBCCCSE
T ss_pred ccccccCCccceEEEecCCcEEEEecchHHHHHHHHHHHHHHHHHHHHcCCCCCchHHHHHHHHHHHHHhcccccCccce
Confidence 46777788999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeEEEEEcCCCCCeEEEECCCcceeceeeeecCCChHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHhhhcccCCCCeEE
Q 029584 82 VAMVLSIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTLQSVLQEDFKASEIE 161 (191)
Q Consensus 82 ~~iv~G~d~~~~p~Ly~~d~~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~~~s~eea~~l~~~~l~~~~~~d~~~~~ie 161 (191)
++||+|||+++||+||.+||+|++.+++++|+|+|++.++++||++|.+.++||++||++++++||+.+.++|..+++++
T Consensus 136 ~~ll~G~D~~~g~~Ly~~Dp~G~~~~~~~~a~G~gs~~~~~~Le~~~~~~~d~t~eeai~l~~~~l~~~~~~d~~~~~ie 215 (244)
T d1irua_ 136 CMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIE 215 (244)
T ss_dssp EEEEEEEETTTEEEEEEECTTSCEEEBSEEEEETTHHHHHHHHHHHTTSCCCCCHHHHHHHHHHHHHHHTTCCCCTTSEE
T ss_pred eeEEEEEcCCCCcEEEEEcCCccEEecceEeccCchhHHHHHHHhccccccCCCHHHHHHHHHHHHHHHHhcCCCCCcEE
Confidence 99999999867899999999999999999999999999999999999767899999999999999999999998888999
Q ss_pred EEEEEeCCCcEEEcCHHHHHHHHHHhhcc
Q 029584 162 VGVVSKENPEFRVLSIEEIDEHLTAISER 190 (191)
Q Consensus 162 i~iv~~~~~~~~~~~~~~i~~~~~~~~~~ 190 (191)
|+|+++++++|++++++||+++|.++++|
T Consensus 216 v~ii~~~~~~~~~l~~~ei~~~l~~~~~r 244 (244)
T d1irua_ 216 VGVVTVENPKFRILTEAEIDAHLVALAER 244 (244)
T ss_dssp EEEEETTEEEEEECCHHHHHHHHHHHHTC
T ss_pred EEEEEeCCCcEEECCHHHHHHHHHHHhcC
Confidence 99999998789999999999999999886
|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|