Citrus Sinensis ID: 029589

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MAPKRGGKVAAAPAKKKPEKVVNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGSVNILNS
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHccccEEEEEEccccccHHHHEHHHHHHHccccEEEEcccHHHHccccccc
cccccccccccccHHHHccccccccHccccccccccccccccccccHEccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccHHHHHcHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHccccEEEEEcccEcEEEEEEcc
mapkrggkvaaapakkkpekvvnplfekrpkqfgiggalppkkdlhryvkwpkAIRIQRQRRILRQRlkvppalnqFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAegktveakkpiVVKYGLNHVTYLIEQNKAQLVVIahdvdpieLVVWLPAlcrkmeipycivkgksrlgsvnilns
mapkrggkvaaapakkkpekvvnplfekrpkqfgiggalppkkdlhryvkWPKAIRIQRQRRILrqrlkvppalnqftktlDKNLASSLFKLLLKYRPEDRAAKKERLLKRaqaeaegktveakkpivVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCivkgksrlgsvnilns
MapkrggkvaaapakkkpekvvNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAiriqrqrrilrqrlKVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGSVNILNS
********************************FGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYR**************************KKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLG*******
****************************RPKQFGIGGALPPKKDLHRYVKWPKAIRI***************ALNQFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKR****************VVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGSVNIL**
******************EKVVNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKR*********VEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGSVNILNS
*********************VNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGSVNILNS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPKRGGKVAAAPAKKKPEKVVNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRxxxxxxxxxxxxxxxxxxxxxAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGSVNILNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
P35685258 60S ribosomal protein L7a yes no 0.968 0.717 0.897 9e-95
Q9LZH9256 60S ribosomal protein L7a yes no 0.958 0.714 0.870 3e-91
P49692257 60S ribosomal protein L7a yes no 0.879 0.653 0.892 5e-86
P12970266 60S ribosomal protein L7a yes no 0.900 0.646 0.647 8e-59
Q2TBQ5266 60S ribosomal protein L7a yes no 0.890 0.639 0.654 8e-59
P62425266 60S ribosomal protein L7a yes no 0.890 0.639 0.654 8e-59
Q4R5C2266 60S ribosomal protein L7a N/A no 0.890 0.639 0.654 8e-59
P62424266 60S ribosomal protein L7a yes no 0.890 0.639 0.654 8e-59
O57592266 60S ribosomal protein L7a N/A no 0.890 0.639 0.649 1e-58
P32429266 60S ribosomal protein L7a yes no 0.890 0.639 0.637 2e-57
>sp|P35685|RL7A_ORYSJ 60S ribosomal protein L7a OS=Oryza sativa subsp. japonica GN=RPL7A PE=2 SV=1 Back     alignment and function desciption
 Score =  345 bits (885), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 167/186 (89%), Positives = 180/186 (96%), Gaps = 1/186 (0%)

Query: 1   MAPKRGGKVAAAPAKKKPEKVVNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQ 60
           MAPKRGG+ A  PAKKK EKV NPLFEKRPKQFGIGGALPPKKDLHR+VKWPK +RIQRQ
Sbjct: 1   MAPKRGGR-APVPAKKKTEKVTNPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRQ 59

Query: 61  RRILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAEGKT 120
           RRIL+QRLKVPPALNQFT+TLDKNLA++LFK+LLKYRPED+AAKKERLLKRAQAEAEGKT
Sbjct: 60  RRILKQRLKVPPALNQFTRTLDKNLATNLFKMLLKYRPEDKAAKKERLLKRAQAEAEGKT 119

Query: 121 VEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGK 180
           VEAKKPIVVKYGLNHVTYLIEQ+KAQLVVIAHDVDPIELVVWLPALCRKME+PYCIVKGK
Sbjct: 120 VEAKKPIVVKYGLNHVTYLIEQSKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGK 179

Query: 181 SRLGSV 186
           +RLGS+
Sbjct: 180 ARLGSI 185

Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q9LZH9|RL7A2_ARATH 60S ribosomal protein L7a-2 OS=Arabidopsis thaliana GN=RPL7AB PE=1 SV=1 Back     alignment and function description
>sp|P49692|RL7A1_ARATH 60S ribosomal protein L7a-1 OS=Arabidopsis thaliana GN=RPL7AA PE=1 SV=2 Back     alignment and function description
>sp|P12970|RL7A_MOUSE 60S ribosomal protein L7a OS=Mus musculus GN=Rpl7a PE=2 SV=2 Back     alignment and function description
>sp|Q2TBQ5|RL7A_BOVIN 60S ribosomal protein L7a OS=Bos taurus GN=RPL7A PE=2 SV=3 Back     alignment and function description
>sp|P62425|RL7A_RAT 60S ribosomal protein L7a OS=Rattus norvegicus GN=Rpl7a PE=1 SV=2 Back     alignment and function description
>sp|Q4R5C2|RL7A_MACFA 60S ribosomal protein L7a OS=Macaca fascicularis GN=RPL7A PE=2 SV=1 Back     alignment and function description
>sp|P62424|RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens GN=RPL7A PE=1 SV=2 Back     alignment and function description
>sp|O57592|RL7A_TAKRU 60S ribosomal protein L7a OS=Takifugu rubripes GN=rpl7a PE=3 SV=3 Back     alignment and function description
>sp|P32429|RL7A_CHICK 60S ribosomal protein L7a OS=Gallus gallus GN=RPL7A PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
255569920 570 60S ribosomal protein L7a, putative [Ric 0.968 0.324 0.918 5e-95
242049786258 hypothetical protein SORBIDRAFT_02g02938 0.968 0.717 0.897 4e-93
115475908258 Os08g0326400 [Oryza sativa Japonica Grou 0.968 0.717 0.897 5e-93
297734458 300 unnamed protein product [Vitis vinifera] 0.968 0.616 0.892 8e-93
225456392258 PREDICTED: 60S ribosomal protein L7a-lik 0.968 0.717 0.892 2e-92
226502084258 60S ribosomal protein L7a [Zea mays] gi| 0.968 0.717 0.887 3e-92
226497590258 LOC100282418 [Zea mays] gi|195622244|gb| 0.968 0.717 0.887 3e-92
357159281258 PREDICTED: 60S ribosomal protein L7a-lik 0.968 0.717 0.892 5e-92
326499075259 predicted protein [Hordeum vulgare subsp 0.968 0.714 0.893 5e-91
225451833258 PREDICTED: 60S ribosomal protein L7a [Vi 0.968 0.717 0.881 1e-90
>gi|255569920|ref|XP_002525923.1| 60S ribosomal protein L7a, putative [Ricinus communis] gi|223534752|gb|EEF36443.1| 60S ribosomal protein L7a, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  352 bits (902), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 170/185 (91%), Positives = 181/185 (97%)

Query: 2   APKRGGKVAAAPAKKKPEKVVNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQR 61
           APKRG KV+AAPAKKKPEKV NPLFEKRPKQFGIGGALPPKKDLHR+VKWPK ++IQR+R
Sbjct: 313 APKRGVKVSAAPAKKKPEKVQNPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVQIQRKR 372

Query: 62  RILRQRLKVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAEGKTV 121
           RILRQRLKVPPALNQFTKTLDKNLA+SLFKLLLKYRPEDRAAK+ERL++RAQAEAEGKTV
Sbjct: 373 RILRQRLKVPPALNQFTKTLDKNLATSLFKLLLKYRPEDRAAKRERLVQRAQAEAEGKTV 432

Query: 122 EAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKS 181
           EAKKPIVVKYGLNHVTYLIEQ KAQLVVIAHDVDP+ELVVWLPALCRKME+PYCIVKGKS
Sbjct: 433 EAKKPIVVKYGLNHVTYLIEQKKAQLVVIAHDVDPVELVVWLPALCRKMEVPYCIVKGKS 492

Query: 182 RLGSV 186
           RLGSV
Sbjct: 493 RLGSV 497

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|242049786|ref|XP_002462637.1| hypothetical protein SORBIDRAFT_02g029380 [Sorghum bicolor] gi|242049790|ref|XP_002462639.1| hypothetical protein SORBIDRAFT_02g029400 [Sorghum bicolor] gi|241926014|gb|EER99158.1| hypothetical protein SORBIDRAFT_02g029380 [Sorghum bicolor] gi|241926016|gb|EER99160.1| hypothetical protein SORBIDRAFT_02g029400 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|115475908|ref|NP_001061550.1| Os08g0326400 [Oryza sativa Japonica Group] gi|115480049|ref|NP_001063618.1| Os09g0507800 [Oryza sativa Japonica Group] gi|548774|sp|P35685.1|RL7A_ORYSJ RecName: Full=60S ribosomal protein L7a gi|315113253|pdb|3IZR|H Chain H, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome gi|303855|dbj|BAA02156.1| ribosomal protein L7A [Oryza sativa Japonica Group] gi|38423963|dbj|BAD01672.1| 60S ribosomal protein L7A [Oryza sativa Japonica Group] gi|38637005|dbj|BAD03264.1| 60S ribosomal protein L7A [Oryza sativa Japonica Group] gi|113623519|dbj|BAF23464.1| Os08g0326400 [Oryza sativa Japonica Group] gi|113631851|dbj|BAF25532.1| Os09g0507800 [Oryza sativa Japonica Group] gi|125564310|gb|EAZ09690.1| hypothetical protein OsI_31973 [Oryza sativa Indica Group] gi|125606274|gb|EAZ45310.1| hypothetical protein OsJ_29953 [Oryza sativa Japonica Group] gi|215692651|dbj|BAG88071.1| unnamed protein product [Oryza sativa Japonica Group] gi|215692800|dbj|BAG88244.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768136|dbj|BAH00365.1| unnamed protein product [Oryza sativa Japonica Group] gi|218200951|gb|EEC83378.1| hypothetical protein OsI_28791 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|297734458|emb|CBI15705.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456392|ref|XP_002284139.1| PREDICTED: 60S ribosomal protein L7a-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|226502084|ref|NP_001147139.1| 60S ribosomal protein L7a [Zea mays] gi|194699752|gb|ACF83960.1| unknown [Zea mays] gi|195607614|gb|ACG25637.1| 60S ribosomal protein L7a [Zea mays] gi|414589924|tpg|DAA40495.1| TPA: 60S ribosomal protein L7a [Zea mays] Back     alignment and taxonomy information
>gi|226497590|ref|NP_001148801.1| LOC100282418 [Zea mays] gi|195622244|gb|ACG32952.1| 60S ribosomal protein L7a [Zea mays] gi|219887097|gb|ACL53923.1| unknown [Zea mays] gi|414886143|tpg|DAA62157.1| TPA: 60S ribosomal protein L7a [Zea mays] Back     alignment and taxonomy information
>gi|357159281|ref|XP_003578397.1| PREDICTED: 60S ribosomal protein L7a-like [Brachypodium distachyon] gi|357166491|ref|XP_003580728.1| PREDICTED: 60S ribosomal protein L7a-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326499075|dbj|BAK06028.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326528305|dbj|BAJ93334.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|225451833|ref|XP_002281689.1| PREDICTED: 60S ribosomal protein L7a [Vitis vinifera] gi|147858681|emb|CAN81023.1| hypothetical protein VITISV_030542 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
TAIR|locus:2081715256 AT3G62870 [Arabidopsis thalian 0.858 0.640 0.829 1.3e-70
TAIR|locus:2062057257 AT2G47610 [Arabidopsis thalian 0.858 0.638 0.829 1.6e-70
CGD|CAL0000666262 RPL82 [Candida albicans (taxid 0.858 0.625 0.602 3.7e-48
CGD|CAL0005018262 RPL8B [Candida albicans (taxid 0.858 0.625 0.602 3.7e-48
UNIPROTKB|Q59WJ0262 RPL82 "Likely cytosolic riboso 0.858 0.625 0.602 3.7e-48
UNIPROTKB|Q5ANA1262 RPL8B "Likely cytosolic riboso 0.858 0.625 0.602 3.7e-48
ZFIN|ZDB-GENE-031001-9266 rpl7a "ribosomal protein L7a" 0.848 0.609 0.607 6e-48
UNIPROTKB|Q2TBQ5266 RPL7A "60S ribosomal protein L 0.848 0.609 0.601 9.8e-48
UNIPROTKB|F2Z4P2266 RPL7A "Uncharacterized protein 0.848 0.609 0.601 9.8e-48
UNIPROTKB|P62424266 RPL7A "60S ribosomal protein L 0.848 0.609 0.601 9.8e-48
TAIR|locus:2081715 AT3G62870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 715 (256.8 bits), Expect = 1.3e-70, P = 1.3e-70
 Identities = 136/164 (82%), Positives = 146/164 (89%)

Query:    23 NPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAXXXXXXXXXXXXXXKVPPALNQFTKTLD 82
             NPLFE+RPKQFGIGGALPPKKDL RY+KWPK+              KVPPALNQFTKTLD
Sbjct:    20 NPLFERRPKQFGIGGALPPKKDLSRYIKWPKSIRLQRQKRILKQRLKVPPALNQFTKTLD 79

Query:    83 KNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQ 142
             KNLA+SLFK+LLKYRPED+AAKKERLL +AQAEAEGK  E+KKPIVVKYGLNHVTYLIEQ
Sbjct:    80 KNLATSLFKILLKYRPEDKAAKKERLLNKAQAEAEGKPAESKKPIVVKYGLNHVTYLIEQ 139

Query:   143 NKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGSV 186
             NKAQLVVIAHDVDPIELVVWLPALCRKME+PYCIVKGKSRLG+V
Sbjct:   140 NKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGKSRLGAV 183
GO:0005737 "cytoplasm" evidence=ISM
GO:0030529 "ribonucleoprotein complex" evidence=IEA
GO:0042254 "ribosome biogenesis" evidence=IEA
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0006412 "translation" evidence=ISS
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0022625 "cytosolic large ribosomal subunit" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0001510 "RNA methylation" evidence=RCA
TAIR|locus:2062057 AT2G47610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0000666 RPL82 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
CGD|CAL0005018 RPL8B [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59WJ0 RPL82 "Likely cytosolic ribosomal protein L8" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ANA1 RPL8B "Likely cytosolic ribosomal protein L8" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031001-9 rpl7a "ribosomal protein L7a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TBQ5 RPL7A "60S ribosomal protein L7a" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4P2 RPL7A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P62424 RPL7A "60S ribosomal protein L7a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35685RL7A_ORYSJNo assigned EC number0.89780.96850.7170yesno
Q966C6RL7A_CAEELNo assigned EC number0.57730.87430.6301yesno
O13672RL8_SCHPONo assigned EC number0.62100.96850.7142yesno
P62424RL7A_HUMANNo assigned EC number0.65490.89000.6390yesno
P62425RL7A_RATNo assigned EC number0.65490.89000.6390yesno
Q9LZH9RL7A2_ARATHNo assigned EC number0.87090.95810.7148yesno
P49692RL7A1_ARATHNo assigned EC number0.89280.87950.6536yesno
P32429RL7A_CHICKNo assigned EC number0.63740.89000.6390yesno
P17076RL8A_YEASTNo assigned EC number0.60200.96330.7187yesno
P12970RL7A_MOUSENo assigned EC number0.64730.90050.6466yesno
Q2TBQ5RL7A_BOVINNo assigned EC number0.65490.89000.6390yesno
O76732RL7A_ANOGANo assigned EC number0.60.85860.6051yesno
P29453RL8B_YEASTNo assigned EC number0.59680.96330.7187yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
4345279
ribosomal protein L7Ae, putative, expressed (258 aa)
(Oryza sativa Japonica)
Predicted Functional Partners:
4333387
60S ribosomal protein L15, putative, expressed (204 aa)
   •••• 0.857
4332813
40S ribosomal protein S21, putative, expressed (82 aa)
   • •• 0.850
4352560
60S ribosomal protein L8, putative, expressed (261 aa)
   •••• 0.843
4342563
ribosomal protein L4, putative, expressed (405 aa)
   •••• 0.817
OsI_13894
ribosomal protein L4, putative, expressed (404 aa)
   •••• 0.815
4342408
ribosomal protein L7Ae, putative, expressed (138 aa)
   • •• 0.800
4333148
40S ribosomal protein S19, putative (146 aa)
   • •• 0.772
4339162
ribosomal protein L7Ae, putative, expressed (129 aa)
   •••• 0.763
4327999
ribosomal protein L6, putative, expressed (192 aa)
   •••• 0.745
4332209
ribosomal protein L7Ae, putative, expressed (128 aa)
   •  • 0.739

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
PTZ00365266 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-lik 9e-80
PTZ00222263 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Pro 2e-48
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 1e-20
COG1358116 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L3 1e-13
PRK04175122 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Vali 1e-12
TIGR03677117 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae 7e-12
>gnl|CDD|240382 PTZ00365, PTZ00365, 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information 
 Score =  238 bits (608), Expect = 9e-80
 Identities = 120/176 (68%), Positives = 140/176 (79%), Gaps = 1/176 (0%)

Query: 10  AAAPAKKKPEKVV-NPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRL 68
           A AP KK  +K   +PLFEK P+ F IGG + PK DL RYV+WP+ I +QRQRR+L QRL
Sbjct: 13  APAPLKKSKKKKQKHPLFEKTPRNFRIGGDIRPKVDLSRYVRWPRYILLQRQRRVLLQRL 72

Query: 69  KVPPALNQFTKTLDKNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAEGKTVEAKKPIV 128
           KVPPALNQFT TLDKN AS L +LL KY+PE RA KK RLLK A+  A G+ VE+KKP +
Sbjct: 73  KVPPALNQFTYTLDKNQASQLLRLLSKYKPETRAEKKARLLKEAEKAAAGEEVESKKPFM 132

Query: 129 VKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLG 184
           +KYGLNHVT L+E  KA+LVVIAHDVDPIELV +LPALCRK E+PYCI+KGKSRLG
Sbjct: 133 LKYGLNHVTDLVEYKKAKLVVIAHDVDPIELVCFLPALCRKKEVPYCIIKGKSRLG 188

Length = 266
>gnl|CDD|140249 PTZ00222, PTZ00222, 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information
>gnl|CDD|224277 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179766 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>gnl|CDD|188367 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
PTZ00365266 60S ribosomal protein L7Ae-like; Provisional 100.0
PTZ00222263 60S ribosomal protein L7a; Provisional 100.0
KOG3166209 consensus 60S ribosomal protein L7A [Translation, 100.0
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 99.86
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 99.77
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 99.7
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 99.7
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 99.68
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 99.67
PRK0668382 hypothetical protein; Provisional 99.64
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 99.62
PRK0101899 50S ribosomal protein L30e; Reviewed 99.54
KOG3387131 consensus 60S ribosomal protein 15.5kD/SNU13, NHP2 99.51
KOG3167153 consensus Box H/ACA snoRNP component, involved in 99.51
PRK07714100 hypothetical protein; Provisional 99.43
PTZ00106108 60S ribosomal protein L30; Provisional 99.42
PRK0728398 hypothetical protein; Provisional 99.38
PRK05583104 ribosomal protein L7Ae family protein; Provisional 99.2
PRK09190220 hypothetical protein; Provisional 99.14
KOG3406134 consensus 40S ribosomal protein S12 [Translation, 99.06
COG1911100 RPL30 Ribosomal protein L30E [Translation, ribosom 97.84
KOG2988112 consensus 60S ribosomal protein L30 [Translation, 94.21
PF08228158 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR0 94.15
PF0803276 SpoU_sub_bind: RNA 2'-O ribose methyltransferase s 94.02
PF03465113 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This do 93.94
PF15608100 PELOTA_1: PELOTA RNA binding domain 93.05
PRK04011411 peptide chain release factor 1; Provisional 90.98
TIGR00108409 eRF peptide chain release factor eRF/aRF, subunit 90.15
PF1008797 DUF2325: Uncharacterized protein conserved in bact 89.94
TIGR03676403 aRF1/eRF1 peptide chain release factor 1, archaeal 88.08
TIGR00111351 pelota probable translation factor pelota. This mo 85.63
PF13727175 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B. 85.04
PF07997120 DUF1694: Protein of unknown function (DUF1694); In 80.74
>PTZ00365 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.8e-81  Score=540.58  Aligned_cols=179  Identities=65%  Similarity=1.035  Sum_probs=173.2

Q ss_pred             cccccCCccccCCccccCCCccccCCCCCCCCccccccccchhhHhHHHHHHHHhhhcCCCccccccccCChhhHHHHHh
Q 029589           12 APAKKKPEKVVNPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAIRIQRQRRILRQRLKVPPALNQFTKTLDKNLASSLFK   91 (191)
Q Consensus        12 ~~~~~~~kk~~nplfekrpknfgig~~iqpkrdltrfvkwP~yirlQrq~~il~~rlKvppainqf~~~l~~~~a~~l~k   91 (191)
                      ..++.+.++++|||||+|||||||||||||+|||||||+||+||||||||+||++||||||+||||+++||+|+|+|||+
T Consensus        16 ~~~~~~~~k~~~plfe~rpknf~iG~~iqpkrdlsrfvkwP~yirlQRqk~iL~~RlKvPp~inqF~~~ldk~~a~~lfk   95 (266)
T PTZ00365         16 PLKKSKKKKQKHPLFEKTPRNFRIGGDIRPKVDLSRYVRWPRYILLQRQRRVLLQRLKVPPALNQFTYTLDKNQASQLLR   95 (266)
T ss_pred             cccccccccccCcccccCccccCcCCCCCCCccchhhcccchhhhHHHHHHHHHHhcCCCccHhhhhhhhcHhhHHHHHH
Confidence            33455667889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcCCcccHHHHHHHHHHHHHHHHcCCCcccCCCceeeechhHHHHHHHhcCcceEEEecCCCccchhhhHHHHHHhcC
Q 029589           92 LLLKYRPEDRAAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKME  171 (191)
Q Consensus        92 l~~kyrPEt~~ekk~rl~~~a~~~a~gk~~~~k~p~~L~~G~~~Vtk~IekkKAkLVVIA~DvdP~elv~~LpaLC~k~~  171 (191)
                      |++||||||++||++||++.||++|+|++.++++|..|.+|+|+|+++|++++|+|||||+||||++++.|||+||++|+
T Consensus        96 ll~KYrPEtk~~kk~RL~~~A~~~a~g~~~~~kkp~~vk~Gin~VtklIekkKAkLVIIA~DVsP~t~kk~LP~LC~k~~  175 (266)
T PTZ00365         96 LLSKYKPETRAEKKARLLKEAEKAAAGEEVESKKPFMLKYGLNHVTDLVEYKKAKLVVIAHDVDPIELVCFLPALCRKKE  175 (266)
T ss_pred             HHHhcCCccHHHHHHHHHHHHHHHhcCCCCCCCCchHHHhhhHHHHHHHHhCCccEEEEeCCCCHHHHHHHHHHHHhccC
Confidence            99999999999999999999999999999779999999999999999999999999999999999999999999999999


Q ss_pred             CCEEEECCHhHHhhhhCCC
Q 029589          172 IPYCIVKGKSRLGSVNILN  190 (191)
Q Consensus       172 VPy~iV~sK~~LG~a~Gi~  190 (191)
                      ||||+++|+++||+++|.+
T Consensus       176 VPY~iv~sK~eLG~AIGkk  194 (266)
T PTZ00365        176 VPYCIIKGKSRLGKLVHQK  194 (266)
T ss_pred             CCEEEECCHHHHHHHhCCC
Confidence            9999999999999999964

>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>KOG3166 consensus 60S ribosomal protein L7A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>KOG3387 consensus 60S ribosomal protein 15 Back     alignment and domain information
>KOG3167 consensus Box H/ACA snoRNP component, involved in ribosomal RNA pseudouridinylation [RNA processing and modification] Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK07283 hypothetical protein; Provisional Back     alignment and domain information
>PRK05583 ribosomal protein L7Ae family protein; Provisional Back     alignment and domain information
>PRK09190 hypothetical protein; Provisional Back     alignment and domain information
>KOG3406 consensus 40S ribosomal protein S12 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2988 consensus 60S ribosomal protein L30 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08228 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR013241 This family of fungal proteins form a subunit of RNase P, the ribonucleoprotein enzyme that cleaves the leader sequence of precursor tRNAs to generate mature tRNAs Back     alignment and domain information
>PF08032 SpoU_sub_bind: RNA 2'-O ribose methyltransferase substrate binding; InterPro: IPR013123 Most cellular RNAs undergo a number of post-transcriptional nucleoside modifications Back     alignment and domain information
>PF03465 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This domain is found in the release factor eRF1 which terminates protein biosynthesis by recognizing stop codons at the A site of the ribosome and stimulating peptidyl-tRNA bond hydrolysis at the peptidyl transferase centre Back     alignment and domain information
>PF15608 PELOTA_1: PELOTA RNA binding domain Back     alignment and domain information
>PRK04011 peptide chain release factor 1; Provisional Back     alignment and domain information
>TIGR00108 eRF peptide chain release factor eRF/aRF, subunit 1 Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms Back     alignment and domain information
>TIGR00111 pelota probable translation factor pelota Back     alignment and domain information
>PF13727 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B Back     alignment and domain information
>PF07997 DUF1694: Protein of unknown function (DUF1694); InterPro: IPR012543 This family contains many hypothetical proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3izr_H258 Localization Of The Large Subunit Ribosomal Protein 3e-79
2zkr_f266 Structure Of A Mammalian Ribosomal 60s Subunit With 3e-51
4a17_F255 T.Thermophila 60s Ribosomal Subunit In Complex With 4e-51
3izs_H256 Localization Of The Large Subunit Ribosomal Protein 4e-48
3zf7_x276 High-resolution Cryo-electron Microscopy Structure 1e-37
1s1i_G119 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 8e-26
3jyw_G113 Structure Of The 60s Proteins For Eukaryotic Riboso 1e-24
2fc3_A124 Crystal Structure Of The Extremely Thermostable Aer 4e-10
3lwo_C123 Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONT 1e-09
3nmu_C129 Crystal Structure Of Substrate-Bound Halfmer Box CD 1e-09
2hvy_D130 Crystal Structure Of An HACA BOX RNP FROM PYROCOCCU 1e-09
2czw_A124 Crystal Structure Analysis Of Protein Component Ph1 1e-09
3hjw_C120 Structure Of A Functional Ribonucleoprotein Pseudou 1e-09
1pxw_A128 Crystal Structure Of L7ae Srnp Core Protein From Py 2e-09
3id5_C130 Crystal Structure Of Sulfolobus Solfataricus CD RNP 1e-08
1rlg_A119 Molecular Basis Of Box CD RNA-Protein Interaction: 1e-08
3paf_A117 M. Jannaschii L7ae Mutant Length = 117 8e-08
1ra4_A120 Crystal Structure Of The Methanococcus Jannaschii L 9e-08
1sds_A117 Structure Of Protein L7ae Bound To A K-Turn Derived 9e-08
3o85_A122 Giardia Lamblia 15.5kd Rna Binding Protein Length = 6e-07
3g4s_F119 Co-Crystal Structure Of Tiamulin Bound To The Large 3e-06
1s72_F120 Refined Crystal Structure Of The Haloarcula Marismo 3e-06
1ffk_E119 Crystal Structure Of The Large Ribosomal Subunit Fr 4e-06
2jnb_A144 Solution Structure Of Rna-Binding Protein 15.5k Len 1e-05
2ozb_A130 Structure Of A Human Prp31-15.5k-U4 Snrna Complex L 1e-05
1e7k_A128 Crystal Structure Of The Spliceosomal 15.5kd Protei 2e-05
2lbx_A121 Solution Structure Of The S. Cerevisiae HACA RNP PR 3e-05
2ale_A134 Crystal Structure Of Yeast Rna Splicing Factor Snu1 5e-05
1zwz_A126 Structural Comparison Of Yeast Snornp And Splicesom 6e-05
2aif_A135 Crystal Structure Of High Mobility Like Protein, Nh 7e-05
2lbw_A121 Solution Structure Of The S. Cerevisiae HACA RNP PR 2e-04
>pdb|3IZR|H Chain H, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 258 Back     alignment and structure 
Iteration: 1

 Score =  290 bits (743), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 139/164 (84%), Positives = 149/164 (90%)
Query: 23  NPLFEKRPKQFGIGGALPPKKDLHRYVKWPKAXXXXXXXXXXXXXXKVPPALNQFTKTLD 82
           NPLFEKRPKQFGIGGALPPKKDLHR+VKWPK               KVPPALNQFT+TLD
Sbjct: 22  NPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRQRRILKQRLKVPPALNQFTRTLD 81
Query: 83  KNLASSLFKLLLKYRPEDRAAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQ 142
           KNLA++LFK+LLKYRPED+AAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQ
Sbjct: 82  KNLATNLFKMLLKYRPEDKAAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQ 141
Query: 143 NKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGSV 186
           +KAQLVVIAHDVDPIELVVWLPALCRKME+PYCIVKGK+RLGS+
Sbjct: 142 SKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGKARLGSI 185
>pdb|2ZKR|FF Chain f, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 266 Back     alignment and structure
>pdb|4A17|F Chain F, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 255 Back     alignment and structure
>pdb|3IZS|H Chain H, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 256 Back     alignment and structure
>pdb|3ZF7|XX Chain x, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 276 Back     alignment and structure
>pdb|1S1I|G Chain G, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 119 Back     alignment and structure
>pdb|3JYW|G Chain G, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 113 Back     alignment and structure
>pdb|2FC3|A Chain A, Crystal Structure Of The Extremely Thermostable Aeropyrum Pernix L7ae Multifunctional Protein Length = 124 Back     alignment and structure
>pdb|3LWO|C Chain C, Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONTAINING 5BRU Length = 123 Back     alignment and structure
>pdb|3NMU|C Chain C, Crystal Structure Of Substrate-Bound Halfmer Box CD RNP Length = 129 Back     alignment and structure
>pdb|2HVY|D Chain D, Crystal Structure Of An HACA BOX RNP FROM PYROCOCCUS FURIOSUS Length = 130 Back     alignment and structure
>pdb|2CZW|A Chain A, Crystal Structure Analysis Of Protein Component Ph1496p Of P.Horikoshii Ribonuclease P Length = 124 Back     alignment and structure
>pdb|3HJW|C Chain C, Structure Of A Functional Ribonucleoprotein Pseudouridine Synthase Bound To A Substrate Rna Length = 120 Back     alignment and structure
>pdb|1PXW|A Chain A, Crystal Structure Of L7ae Srnp Core Protein From Pyrococcus Abyssii Length = 128 Back     alignment and structure
>pdb|3ID5|C Chain C, Crystal Structure Of Sulfolobus Solfataricus CD RNP ASSEMBLED WITH Nop5, Fibrillarin, L7ae And A Split Half CD RNA Length = 130 Back     alignment and structure
>pdb|1RLG|A Chain A, Molecular Basis Of Box CD RNA-Protein Interaction: Co- Crystal Structure Of The Archaeal Srnp Intiation Complex Length = 119 Back     alignment and structure
>pdb|3PAF|A Chain A, M. Jannaschii L7ae Mutant Length = 117 Back     alignment and structure
>pdb|1RA4|A Chain A, Crystal Structure Of The Methanococcus Jannaschii L7ae Protein Length = 120 Back     alignment and structure
>pdb|1SDS|A Chain A, Structure Of Protein L7ae Bound To A K-Turn Derived From An Archaeal Box HACA SRNA Length = 117 Back     alignment and structure
>pdb|3O85|A Chain A, Giardia Lamblia 15.5kd Rna Binding Protein Length = 122 Back     alignment and structure
>pdb|3G4S|F Chain F, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 119 Back     alignment and structure
>pdb|1S72|F Chain F, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 120 Back     alignment and structure
>pdb|1FFK|E Chain E, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 119 Back     alignment and structure
>pdb|2JNB|A Chain A, Solution Structure Of Rna-Binding Protein 15.5k Length = 144 Back     alignment and structure
>pdb|2OZB|A Chain A, Structure Of A Human Prp31-15.5k-U4 Snrna Complex Length = 130 Back     alignment and structure
>pdb|1E7K|A Chain A, Crystal Structure Of The Spliceosomal 15.5kd Protein Bound To A U4 Snrna Fragment Length = 128 Back     alignment and structure
>pdb|2LBX|A Chain A, Solution Structure Of The S. Cerevisiae HACA RNP PROTEIN NHP2P Length = 121 Back     alignment and structure
>pdb|2ALE|A Chain A, Crystal Structure Of Yeast Rna Splicing Factor Snu13p Length = 134 Back     alignment and structure
>pdb|1ZWZ|A Chain A, Structural Comparison Of Yeast Snornp And Splicesomal Protein Snu13p With Its Homologs Length = 126 Back     alignment and structure
>pdb|2AIF|A Chain A, Crystal Structure Of High Mobility Like Protein, Nhp2, Putative From Cryptosporidium Parvum Length = 135 Back     alignment and structure
>pdb|2LBW|A Chain A, Solution Structure Of The S. Cerevisiae HACA RNP PROTEIN NHP2P-S82w Mutant Length = 121 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 2e-56
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 1e-54
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 3e-54
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 6e-51
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 4e-26
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 7e-25
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 1e-22
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 9e-22
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 1e-21
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 4e-21
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 3e-19
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 2e-18
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 3e-18
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 4e-18
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 6e-18
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 4e-14
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 1e-06
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 1e-04
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Length = 255 Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 266 Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Length = 113 Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Length = 135 Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Length = 144 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Length = 122 Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Length = 124 Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Length = 134 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Length = 120 Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Length = 119 Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Length = 126 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Length = 120 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Length = 121 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Length = 82 Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Length = 143 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 100.0
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 100.0
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 100.0
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 100.0
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 99.94
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 99.81
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.81
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 99.8
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 99.79
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 99.79
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 99.78
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.78
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 99.77
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 99.76
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 99.75
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 99.72
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 99.66
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 99.66
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 99.65
1w41_A101 50S ribosomal protein L30E; electrostatic interact 99.65
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 99.61
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 99.61
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 99.59
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 99.57
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 99.57
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 99.5
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 99.32
3cg6_A146 Growth arrest and DNA-damage-inducible 45 gamma; a 98.67
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 98.5
3ir9_A166 Peptide chain release factor subunit 1; structural 93.07
3agk_A373 Peptide chain release factor subunit 1; translatio 91.19
1dt9_A437 ERF1, protein (eukaryotic peptide chain release fa 87.25
2qi2_A347 Pelota, cell division protein pelota related prote 86.87
3e20_C441 Eukaryotic peptide chain release factor subunit 1; 86.33
1x52_A124 Pelota homolog, CGI-17; ERF1_3 domain, structural 85.82
1b93_A152 Protein (methylglyoxal synthase); glycolytic bypas 83.53
2ohw_A133 YUEI protein; structural genomics, PSI-2, protein 83.23
3obw_A364 Protein pelota homolog; SM fold, hydrolase; 2.60A 83.11
3j15_A357 Protein pelota; ribosome recycling, ribosome, arch 82.83
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 82.72
2xw6_A134 MGS, methylglyoxal synthase; lyase; 1.08A {Thermus 81.99
1vmd_A178 MGS, methylglyoxal synthase; TM1185, structural ge 81.88
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>3cg6_A Growth arrest and DNA-damage-inducible 45 gamma; alpha/beta, cell cycle; 1.70A {Mus musculus} PDB: 2wal_A Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Back     alignment and structure
>3ir9_A Peptide chain release factor subunit 1; structural genomics, APC36528.1, C-terminal domain, PSI-2, protein structure initiative; 2.21A {Methanosarcina mazei} Back     alignment and structure
>3agk_A Peptide chain release factor subunit 1; translation; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1dt9_A ERF1, protein (eukaryotic peptide chain release factor subunit 1); tRNA mimicry, protein sythesis, STOP codon recognition, peptidyl-tRNA hydrolysis; 2.70A {Homo sapiens} SCOP: c.55.4.2 d.79.3.2 d.91.1.1 PDB: 3e1y_A* 2ktu_A 2ktv_A 2lgt_A 2hst_A Back     alignment and structure
>2qi2_A Pelota, cell division protein pelota related protein; DOM34, cell cycle; 2.90A {Thermoplasma acidophilum} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 Back     alignment and structure
>3e20_C Eukaryotic peptide chain release factor subunit 1; SUP35, SUP45, translation termination, peptide release, GTP- nucleotide-binding; 3.50A {Schizosaccharomyces pombe} Back     alignment and structure
>1x52_A Pelota homolog, CGI-17; ERF1_3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.79.3.2 Back     alignment and structure
>1b93_A Protein (methylglyoxal synthase); glycolytic bypass, lyase; 1.90A {Escherichia coli} SCOP: c.24.1.2 PDB: 1egh_A 1ik4_A* 1s8a_A 1s89_A Back     alignment and structure
>2ohw_A YUEI protein; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.40A {Bacillus subtilis} SCOP: d.79.8.1 Back     alignment and structure
>3obw_A Protein pelota homolog; SM fold, hydrolase; 2.60A {Sulfolobus solfataricus} Back     alignment and structure
>3j15_A Protein pelota; ribosome recycling, ribosome, archaea, translation-transport complex; HET: ADP; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>2xw6_A MGS, methylglyoxal synthase; lyase; 1.08A {Thermus SP} PDB: 2x8w_A 1wo8_A Back     alignment and structure
>1vmd_A MGS, methylglyoxal synthase; TM1185, structural genomics, JCSG, P structure initiative, PSI, joint center for structural GENO lyase; 2.06A {Thermotoga maritima} SCOP: c.24.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 3e-17
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 9e-16
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 9e-16
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 1e-14
d2ozba1125 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Hu 3e-14
d2alea1126 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein 6e-14
d2aifa1115 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Crypto 3e-12
d1w3ex198 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 2e-08
d2bo1a1100 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 9e-06
d1t0kb_97 d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 3e-05
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Ribosomal protein L7ae
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

 Score = 71.8 bits (176), Expect = 3e-17
 Identities = 34/87 (39%), Positives = 46/87 (52%), Gaps = 11/87 (12%)

Query: 98  PEDRAAKKERLLKRAQAEAEGKTVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPI 157
           PED   +   LL++ +         + K   VK G N  T  +E+  A+LV IA DVDP 
Sbjct: 2   PEDMQNEALSLLEKVRE--------SGK---VKKGTNETTKAVERGLAKLVYIAEDVDPP 50

Query: 158 ELVVWLPALCRKMEIPYCIVKGKSRLG 184
           E+V  LP LC +  +PY  VK K+ LG
Sbjct: 51  EIVAHLPLLCEEKNVPYIYVKSKNDLG 77
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Length = 126 Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Length = 115 Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d2alea1126 Small nuclear ribonucleoprotein-associated protein 99.82
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 99.81
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 99.8
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 99.8
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 99.78
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 99.78
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 99.77
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.49
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 99.47
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.45
d1gz0a276 RlmB, N-terminal domain {Escherichia coli [TaxId: 96.48
d1dt9a2146 C-terminal domain of eukaryotic peptide chain rele 94.19
d2vgna3104 Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} 92.13
d1x52a1111 Cell division protein pelota {Human (Homo sapiens) 91.4
d2qi2a395 Cell division protein pelota {Thermoplasma acidoph 88.63
d1vmda_156 Methylglyoxal synthase, MgsA {Thermotoga maritima 80.4
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Small nuclear ribonucleoprotein-associated protein 1, Snu13p
species: Saccharomyces cerevisiae [TaxId: 4932]

Probab=99.82  E-value=1.7e-20  Score=145.02  Aligned_cols=64  Identities=28%  Similarity=0.582  Sum_probs=62.1

Q ss_pred             ceeeechhHHHHHHHhcCcceEEEecCCCccchhhhHHHHHHhcCCCEEEECCHhHHhhhhCCC
Q 029589          127 IVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKSRLGSVNILN  190 (191)
Q Consensus       127 ~~L~~G~~~Vtk~IekkKAkLVVIA~DvdP~elv~~LpaLC~k~~VPy~iV~sK~~LG~a~Gi~  190 (191)
                      ..|.+|+++|+++|++|+++|||||.|++|++++.|+|.+|++++|||+++.++.+||++||++
T Consensus        31 ~~l~~G~~ev~K~i~~g~a~lVviA~D~~p~~~~~~l~~lc~~~~Ip~~~v~sk~~LG~a~G~~   94 (126)
T d2alea1          31 RQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVS   94 (126)
T ss_dssp             TCEEESHHHHHHHHHHTCEEEEEEETTCSSGGGGTHHHHHHHHHTCCEEEESCHHHHHHHTTCS
T ss_pred             CCcccCHHHHHHHHHcCCCeEEEEeCCCChHHHHHHHHHHHhccCCCEEEECchhHHHHHhCCC
Confidence            4689999999999999999999999999999999999999999999999999999999999986
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1gz0a2 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vgna3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qi2a3 d.79.3.2 (A:244-338) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vmda_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure