Citrus Sinensis ID: 029616

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MKYRYAMVCSSNQNRSMEAHYLLKRHGFDVSSYGTGAHVKLPGPSLREPNVYEFGTPYKQMFDDLRRKDPELYKRNGILPMLKRNIGVKAAPQRWQDNALDGSFDIVFTFEEKVFDTVVEDLNTREQPFMKTVLVINLEVKDNHEEAAIGGRLTFDLCQEVCLLLFFIVSLVYHLKHHCTFTGLCIDRSS
cccEEEEEEcccccccHHHHHHHHHccccEEEEcccccEEccccccccccECcccccHHHHHHHHHHccHHHHHHccccccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccCEEEcccc
*KYRYAMVCSSNQNRSMEAHYLLKRHGFDVSSYGTGAHVKLPGPSLREPNVYEFGTPYKQMFDDLRRKDPELYKRNGILPMLKRNIGVKAAPQRWQDNALDGSFDIVFTFEEKVFDTVVEDLNTREQPFMKTVLVINLEVKDNHEEAAIGGRLTFDLCQEVCLLLFFIVSLVYHLKHHCTFTGLCID***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYRYAMVCSSNQNRSMEAHYLLKRHGFDVSSYGTGAHVKLPGPSLREPNVYEFGTPYKQMFDDLRRKDPELYKRNGILPMLKRNIGVKAAPQRWQDNALDGSFDIVFTFEEKVFDTVVEDLNTREQPFMKTVLVINLEVKDNHEEAAIGGRLTFDLCQEVCLLLFFIVSLVYHLKHHCTFTGLCIDRSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA polymerase II subunit A C-terminal domain phosphatase SSU72 Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. SSU72 is required for 3'-end formation of snoRNAs.probableQ6C195
RNA polymerase II subunit A C-terminal domain phosphatase SSU72 May be involved in the C-terminal domain of RNA polymerase II dephosphorylation, RNA processing and termination.probableQ4KLK9
RNA polymerase II subunit A C-terminal domain phosphatase SSU72 May be involved in the C-terminal domain of RNA polymerase II dephosphorylation, RNA processing and termination.probableQ9CY97

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P9Y, chain A
Confidence level:very confident
Coverage over the Query: 2-178
View the alignment between query and template
View the model in PyMOL