Citrus Sinensis ID: 029617


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MVSTTLAATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLHSRRSLSRVSVTNDEEAAAKAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG
ccccccHHHHHHHHHHHHHcccccccEECcccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHccccccccEEEcccEEEEcccccccccEEEEEEccccccccHHHccccHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccEEEEEEccccccccccc
******AATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLH****************************APTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSTTLAATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLHSRRSLSRVSVTNDEEAAAKAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histidine triad nucleotide-binding protein 2, mitochondrial Hydrolase probably involved in steroid biosynthesis. May play a role in apoptosis. Has adenosine phosphoramidase activity.probableQ9BX68
Histidine triad nucleotide-binding protein 2, mitochondrial Hydrolase probably involved in steroid biosynthesis. May play a role in apoptosis. Has adenosine phosphoramidase activity.probableQ8SQ21

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O1C, chain A
Confidence level:very confident
Coverage over the Query: 73-190
View the alignment between query and template
View the model in PyMOL