Citrus Sinensis ID: 029617

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MVSTTLAATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLHSRRSLSRVSVTNDEEAAAKAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG
ccccccHHHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHccccccccEEEcccEEEEcccccccccEEEEEEccccccccHHHccccHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccEEEEEEccccccccccc
ccccEHEHHHHHHHHHHHHHHHHHHccccccccccccHccHcEccccccccccccHHccccHHHHHHHHHcccccccccHHHHHHcccccccEEEEcccEEEEEcccccccEEEEEEEccccccccHHHccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEHHHHccccccccEEEEEccccccccc
MVSTTLAATSFSLLRNYNANVRAFAANvraplqhstnynsinfllplhsrrslsrvsvtNDEEAAAKAAALnagseaptiFDKIIakeipssivyedekvlafrdinpqapvhvliipkfRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVinngpgacqSVYHLHLHVlggrqlkwppg
MVSTTLAATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLHSRRSLSRVSVTNDEEAAAKAAalnagseaptIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVlggrqlkwppg
MVSTTLAATSFSLLrnynanvrafaanvraPLQHSTNYNSINFllplhsrrslsrvsVTNDeeaaakaaalnagseaPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG
******AATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLH****************************APTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQL*****
********TSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPL********************************IFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPP*
MVSTTLAATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLHSRRSLSRVSVTNDEEAAAKAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG
**STTLAATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLHSRRSLSRVSV*****************EAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKW**G
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSTTLAATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLHSRRSLSRVSVTNDEEAAAKAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
P42856128 14 kDa zinc-binding prote N/A no 0.668 0.992 0.692 3e-50
P42855113 14 kDa zinc-binding prote N/A no 0.589 0.991 0.696 4e-44
Q9BX68163 Histidine triad nucleotid yes no 0.689 0.803 0.522 2e-34
Q9D0S9163 Histidine triad nucleotid yes no 0.684 0.797 0.484 5e-34
P32084114 Uncharacterized HIT-like yes no 0.578 0.964 0.580 3e-33
Q8SQ21163 Histidine triad nucleotid yes no 0.684 0.797 0.515 7e-32
P53795130 Histidine triad nucleotid yes no 0.668 0.976 0.5 6e-31
P73481114 Uncharacterized HIT-like N/A no 0.578 0.964 0.589 2e-30
P62958126 Histidine triad nucleotid no no 0.636 0.960 0.512 8e-30
P80912126 Histidine triad nucleotid no no 0.636 0.960 0.504 3e-29
>sp|P42856|ZB14_MAIZE 14 kDa zinc-binding protein OS=Zea mays GN=ZBP14 PE=1 SV=1 Back     alignment and function desciption
 Score =  197 bits (502), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 109/127 (85%)

Query: 64  AAAKAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDG 123
           ++ K AAL    ++PTIFDKII KEIPS++VYEDEKVLAFRDINPQAP H+LIIPK +DG
Sbjct: 2   SSEKEAALRRLDDSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVKDG 61

Query: 124 LTTLAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGR 183
           LT LAKAE RH +ILG+LL  +K+VA++EG+ DG+RVVIN+GP  CQSVYH+H+H+LGGR
Sbjct: 62  LTGLAKAEERHIEILGYLLYVAKVVAKQEGLEDGYRVVINDGPSGCQSVYHIHVHLLGGR 121

Query: 184 QLKWPPG 190
           Q+ WPPG
Sbjct: 122 QMNWPPG 128

Zea mays (taxid: 4577)
>sp|P42855|ZB14_BRAJU 14 kDa zinc-binding protein (Fragment) OS=Brassica juncea PE=3 SV=1 Back     alignment and function description
>sp|Q9BX68|HINT2_HUMAN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens GN=HINT2 PE=1 SV=1 Back     alignment and function description
>sp|Q9D0S9|HINT2_MOUSE Histidine triad nucleotide-binding protein 2, mitochondrial OS=Mus musculus GN=Hint2 PE=2 SV=1 Back     alignment and function description
>sp|P32084|Y1390_SYNE7 Uncharacterized HIT-like protein Synpcc7942_1390 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1390 PE=4 SV=1 Back     alignment and function description
>sp|Q8SQ21|HINT2_BOVIN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Bos taurus GN=HINT2 PE=2 SV=1 Back     alignment and function description
>sp|P53795|HINT_CAEEL Histidine triad nucleotide-binding protein 1 OS=Caenorhabditis elegans GN=hint-1 PE=4 SV=1 Back     alignment and function description
>sp|P73481|YHIT_SYNY3 Uncharacterized HIT-like protein slr1234 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1234 PE=4 SV=1 Back     alignment and function description
>sp|P62958|HINT1_BOVIN Histidine triad nucleotide-binding protein 1 OS=Bos taurus GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|P80912|HINT1_RABIT Histidine triad nucleotide-binding protein 1 OS=Oryctolagus cuniculus GN=HINT1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
224134422185 predicted protein [Populus trichocarpa] 0.963 0.989 0.75 1e-67
357475225182 14 kDa zinc-binding protein [Medicago tr 0.942 0.983 0.701 4e-61
225423666200 PREDICTED: 14 kDa zinc-binding protein-l 0.942 0.895 0.678 8e-61
297737985192 unnamed protein product [Vitis vinifera] 0.942 0.932 0.678 9e-61
351727110178 uncharacterized protein LOC100500187 [Gl 0.910 0.971 0.689 2e-60
449455393183 PREDICTED: 14 kDa zinc-binding protein-l 0.852 0.885 0.757 2e-59
15221629187 histidine triad nucleotide-binding 2 pro 0.968 0.983 0.655 8e-54
297846500185 hypothetical protein ARALYDRAFT_336541 [ 0.968 0.994 0.655 3e-53
326502896178 predicted protein [Hordeum vulgare subsp 0.742 0.792 0.751 2e-52
242093864178 hypothetical protein SORBIDRAFT_10g02670 0.742 0.792 0.737 5e-51
>gi|224134422|ref|XP_002321820.1| predicted protein [Populus trichocarpa] gi|222868816|gb|EEF05947.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 156/184 (84%), Gaps = 1/184 (0%)

Query: 7   AATSFSLLRNYNANVRAFAANVRAPLQHSTNYNSINFLLPLHSRRSLSRVSVTNDEEAAA 66
           A  SFSLLRN     RAF+ NVR   + ++++NSI  + P HS+RSL   +  +DEEA+A
Sbjct: 3   AIGSFSLLRNCAVTTRAFS-NVRVSPRATSSFNSIKLIHPHHSQRSLFCTNAIHDEEASA 61

Query: 67  KAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTT 126
           KAAA +A S APTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVL+IPK RDGLTT
Sbjct: 62  KAAAASADSGAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLVIPKARDGLTT 121

Query: 127 LAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLK 186
           L KAEARHG++LG LL A++IVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQ+K
Sbjct: 122 LGKAEARHGEVLGQLLYAARIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQMK 181

Query: 187 WPPG 190
           WPPG
Sbjct: 182 WPPG 185

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357475225|ref|XP_003607898.1| 14 kDa zinc-binding protein [Medicago truncatula] gi|85719365|gb|ABC75370.1| Histidine triad (HIT) protein [Medicago truncatula] gi|355508953|gb|AES90095.1| 14 kDa zinc-binding protein [Medicago truncatula] gi|388517999|gb|AFK47061.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225423666|ref|XP_002276515.1| PREDICTED: 14 kDa zinc-binding protein-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737985|emb|CBI27186.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351727110|ref|NP_001238173.1| uncharacterized protein LOC100500187 [Glycine max] gi|255629609|gb|ACU15152.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449455393|ref|XP_004145437.1| PREDICTED: 14 kDa zinc-binding protein-like [Cucumis sativus] gi|449521110|ref|XP_004167574.1| PREDICTED: 14 kDa zinc-binding protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15221629|ref|NP_174401.1| histidine triad nucleotide-binding 2 protein [Arabidopsis thaliana] gi|26450224|dbj|BAC42230.1| putative protein kinase C inhibitor [Arabidopsis thaliana] gi|28827592|gb|AAO50640.1| putative protein kinase C inhibitor (Zinc-binding protein) [Arabidopsis thaliana] gi|332193198|gb|AEE31319.1| histidine triad nucleotide-binding 2 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297846500|ref|XP_002891131.1| hypothetical protein ARALYDRAFT_336541 [Arabidopsis lyrata subsp. lyrata] gi|297336973|gb|EFH67390.1| hypothetical protein ARALYDRAFT_336541 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|326502896|dbj|BAJ99076.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|242093864|ref|XP_002437422.1| hypothetical protein SORBIDRAFT_10g026700 [Sorghum bicolor] gi|241915645|gb|EER88789.1| hypothetical protein SORBIDRAFT_10g026700 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
TAIR|locus:2029559187 HINT 2 "HISTIDINE TRIAD NUCLEO 0.594 0.604 0.867 4.1e-49
TAIR|locus:2102554147 HIT3 "HIS triad family protein 0.594 0.768 0.699 7.3e-43
GENEDB_PFALCIPARUM|PF08_0059185 PF08_0059 "protein kinase c in 0.584 0.6 0.598 5.8e-34
ZFIN|ZDB-GENE-070410-139161 hint2 "histidine triad nucleot 0.584 0.689 0.584 5.2e-33
UNIPROTKB|Q8SQ21163 HINT2 "Histidine triad nucleot 0.584 0.680 0.548 8.8e-31
RGD|1308910163 Hint2 "histidine triad nucleot 0.584 0.680 0.530 8.8e-31
UNIPROTKB|Q9BX68163 HINT2 "Histidine triad nucleot 0.584 0.680 0.548 1.1e-30
UNIPROTKB|Q9I882126 chPKCI "Protein kinase C inhib 0.578 0.873 0.571 1.8e-30
UNIPROTKB|E2RF32163 HINT2 "Uncharacterized protein 0.584 0.680 0.539 1.8e-30
UNIPROTKB|Q78DM8126 quPKCI "Protein kinase C inhib 0.578 0.873 0.571 1.8e-30
TAIR|locus:2029559 HINT 2 "HISTIDINE TRIAD NUCLEOTIDE-BINDING 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 512 (185.3 bits), Expect = 4.1e-49, P = 4.1e-49
 Identities = 98/113 (86%), Positives = 103/113 (91%)

Query:    78 PTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDI 137
             PTIFDKIIAKEIPS IVYEDE VLAFRDINPQAPVHVL+IPK RDGLT+L KAE RH ++
Sbjct:    75 PTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIPKLRDGLTSLGKAEPRHVEV 134

Query:   138 LGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG 190
             LG LL ASKIVAEKEGILDGFRVVINNG  ACQSVYHLHLHVLGGRQ+KWPPG
Sbjct:   135 LGQLLHASKIVAEKEGILDGFRVVINNGVEACQSVYHLHLHVLGGRQMKWPPG 187
GO:0003824 "catalytic activity" evidence=IEA
GO:0005080 "protein kinase C binding" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0008270 "zinc ion binding" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2102554 HIT3 "HIS triad family protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF08_0059 PF08_0059 "protein kinase c inhibitor-like protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-139 hint2 "histidine triad nucleotide binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8SQ21 HINT2 "Histidine triad nucleotide-binding protein 2, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1308910 Hint2 "histidine triad nucleotide binding protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BX68 HINT2 "Histidine triad nucleotide-binding protein 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9I882 chPKCI "Protein kinase C inhibitor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RF32 HINT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q78DM8 quPKCI "Protein kinase C inhibitor" [Coturnix japonica (taxid:93934)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8SQ21HINT2_BOVIN3, ., -, ., -, ., -0.51510.68420.7975yesno
Q9BX68HINT2_HUMAN3, ., -, ., -, ., -0.52230.68940.8036yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
cd01276104 cd01276, PKCI_related, Protein Kinase C Interactin 5e-52
COG0537138 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hy 6e-33
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme 2e-32
PRK10687119 PRK10687, PRK10687, purine nucleoside phosphoramid 5e-32
pfam0123097 pfam01230, HIT, HIT domain 7e-32
cd01277103 cd01277, HINT_subgroup, HINT (histidine triad nucl 2e-27
cd0046886 cd00468, HIT_like, HIT family: HIT (Histidine tria 4e-14
cd01278104 cd01278, aprataxin_related, aprataxin related: Apr 2e-07
cd01275126 cd01275, FHIT, FHIT (fragile histidine family): FH 2e-06
>gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information 
 Score =  161 bits (411), Expect = 5e-52
 Identities = 58/106 (54%), Positives = 73/106 (68%), Gaps = 3/106 (2%)

Query: 78  PTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDI 137
             IF KII  EIP+  VYED++VLAF DINPQAPVH+L+IPK      +L+ A     ++
Sbjct: 1   DCIFCKIIRGEIPAKKVYEDDEVLAFHDINPQAPVHILVIPKKHIA--SLSDATEEDEEL 58

Query: 138 LGHLLCASKIVAEKEGI-LDGFRVVINNGPGACQSVYHLHLHVLGG 182
           LGHLL A+  VA+  GI  DG+R+VIN G    Q V+HLHLH+LGG
Sbjct: 59  LGHLLSAAAKVAKDLGIAEDGYRLVINCGKDGGQEVFHLHLHLLGG 104

The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members. Length = 104
>gnl|CDD|223611 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>gnl|CDD|182648 PRK10687, PRK10687, purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>gnl|CDD|216377 pfam01230, HIT, HIT domain Back     alignment and domain information
>gnl|CDD|238608 cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|238263 cd00468, HIT_like, HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|238609 cd01278, aprataxin_related, aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>gnl|CDD|238606 cd01275, FHIT, FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
KOG3275127 consensus Zinc-binding protein of the histidine tr 100.0
PRK10687119 purine nucleoside phosphoramidase; Provisional 100.0
cd01276104 PKCI_related Protein Kinase C Interacting protein 99.97
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 99.97
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 99.96
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 99.95
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 99.94
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 99.93
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 99.92
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 99.91
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 99.91
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 99.89
PLN02643336 ADP-glucose phosphorylase 99.88
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 99.86
KOG3379150 consensus Diadenosine polyphosphate hydrolase and 99.8
KOG4359166 consensus Protein kinase C inhibitor-like protein 99.61
PF02744166 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf 99.55
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [En 99.47
KOG2958354 consensus Galactose-1-phosphate uridylyltransferas 99.14
PF04677121 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In 98.83
KOG0562184 consensus Predicted hydrolase (HIT family) [Genera 98.82
KOG2476 528 consensus Uncharacterized conserved protein [Funct 98.08
PLN03103 403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 97.66
KOG3969310 consensus Uncharacterized conserved protein [Funct 97.25
PRK05471252 CDP-diacylglycerol pyrophosphatase; Provisional 96.79
TIGR00672250 cdh CDP-diacylglycerol pyrophosphatase, bacterial 96.78
cd00608 329 GalT Galactose-1-phosphate uridyl transferase (Gal 96.43
KOG2477 628 consensus Uncharacterized conserved protein [Funct 96.42
KOG2720 431 consensus Predicted hydrolase (HIT family) [Genera 96.4
PF02611222 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: 96.35
COG4360 298 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetr 96.34
COG1085 338 GalT Galactose-1-phosphate uridylyltransferase [En 95.71
PLN02643 336 ADP-glucose phosphorylase 95.47
COG2134252 Cdh CDP-diacylglycerol pyrophosphatase [Lipid meta 95.01
COG5075305 Uncharacterized conserved protein [Function unknow 94.16
PRK11720 346 galactose-1-phosphate uridylyltransferase; Provisi 93.37
TIGR00209 347 galT_1 galactose-1-phosphate uridylyltransferase, 92.51
>KOG3275 consensus Zinc-binding protein of the histidine triad (HIT) family [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=7.8e-41  Score=252.06  Aligned_cols=125  Identities=59%  Similarity=0.966  Sum_probs=116.2

Q ss_pred             hHHHHHHHHHHhcCCCCCceeheecccccCccEEEEcCeEEEEeeCCCCCCeEEEEEeecCCCCCCchhhhhhHHHHHHH
Q 029617           61 DEEAAAKAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGH  140 (190)
Q Consensus        61 ~e~~~a~~~~~~~~~~~~CiFC~Ii~~e~p~~IVyEde~~vaf~d~~P~~pgHvLVIPKrH~~l~dL~~l~~~~~~~L~~  140 (190)
                      +|+++|..+++   .+++|+||+|+++|+|+.+|||||.++||.|+.|++|+|+|||||+|  +..++.+++.+.++|++
T Consensus         3 ~e~~~a~~a~~---~~~~tIF~kIi~keIPa~ii~Edd~~lAF~Di~Pqap~HfLvIPK~h--i~~~s~aed~~~e~Lg~   77 (127)
T KOG3275|consen    3 SEVEKAQTAAA---GAAPTIFCKIIRKEIPAKIIFEDDRCLAFHDIAPQAPGHFLVIPKKH--ITQLSKAEDRDDELLGH   77 (127)
T ss_pred             chHHHHhhhcc---cCCCcEeeeeecccCCcceEeeccceEEEEecCCCCCceEEEeeccc--ccchhhcccCCHHHHHH
Confidence            36666665533   27899999999999999999999999999999999999999999999  78888888888999999


Q ss_pred             HHHHHHHHHHHhCCCCCeEEEEecCCCCCCccceEEEEEEcCCCCCCCCC
Q 029617          141 LLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG  190 (190)
Q Consensus       141 ll~~ak~v~~~~~~~~gyni~in~G~~agqsV~HlHlHVIPR~~~~wp~~  190 (190)
                      +|.+++++++++|+.+|||+++|+|..++|+|+|+|+||||+++|+||||
T Consensus        78 ll~~~k~vak~~Gl~~gYrvv~NnG~~g~QsV~HvH~HvlgGrqm~WPpg  127 (127)
T KOG3275|consen   78 LLPVAKKVAKALGLEDGYRVVQNNGKDGHQSVYHVHLHVLGGRQMQWPPG  127 (127)
T ss_pred             HHHHHHHHHHHhCcccceeEEEcCCcccceEEEEEEEEEeCCcccCCCCC
Confidence            99999999999999999999999999999999999999999999999998

>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>KOG3379 consensus Diadenosine polyphosphate hydrolase and related proteins of the histidine triad (HIT) family [Nucleotide transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG4359 consensus Protein kinase C inhibitor-like protein [General function prediction only] Back     alignment and domain information
>PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>KOG2958 consensus Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues Back     alignment and domain information
>KOG0562 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>KOG3969 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional Back     alignment and domain information
>TIGR00672 cdh CDP-diacylglycerol pyrophosphatase, bacterial type Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>KOG2477 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2720 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>PF02611 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: IPR003763 The CDP-diacylglycerol pyrophosphatases 3 Back     alignment and domain information
>COG4360 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphosphate phosphorylase II) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>COG2134 Cdh CDP-diacylglycerol pyrophosphatase [Lipid metabolism] Back     alignment and domain information
>COG5075 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
3o1z_A126 High Resolution Crystal Structure Of Histidine Tria 7e-30
3o1x_A126 High Resolution Crystal Structure Of Histidine Tria 1e-29
3o1c_A126 High Resolution Crystal Structure Of Histidine Tria 1e-29
1rzy_A126 Crystal Structure Of Rabbit Hint Complexed With N- 2e-29
3rhn_A115 Histidine Triad Nucleotide-Binding Protein (Hint) F 2e-29
4eqe_A128 Crystal Structure Of Histidine Triad Nucleotide-Bin 3e-29
3tw2_A126 High Resolution Structure Of Human Histidine Triad 4e-29
1kpa_A126 Pkci-1-Zinc Length = 126 4e-29
1kpb_A125 Pkci-1-Apo Length = 125 4e-29
3n1s_A119 Crystal Structure Of Wild Type Echint Gmp Complex L 3e-21
3oj7_A117 Crystal Structure Of A Histidine Triad Family Prote 7e-21
3n1t_A119 Crystal Structure Of The H101a Mutant Echint Gmp Co 3e-20
1xqu_A147 Hit Family Hydrolase From Clostridium Thermocellum 7e-20
4egu_A119 0.95a Resolution Structure Of A Histidine Triad Pro 8e-18
3lb5_A161 Crystal Structure Of Hit-Like Protein Involved In C 1e-12
3l7x_A173 The Crystal Structure Of Smu.412c From Streptococcu 6e-11
1y23_A145 Crystal Structure Of A Member Of Hit Family Of Prot 1e-09
3ksv_A149 Hypothetical Protein From Leishmania Major Length = 2e-09
3imi_A147 2.01 Angstrom Resolution Crystal Structure Of A Hit 3e-09
3o0m_A149 Crystal Structure Of A Zn-Bound Histidine Triad Fam 2e-08
2eo4_A149 Crystal Structure Of Hypothetical Histidine Triad N 4e-07
3p0t_A138 Crystal Structure Of An Hit-Like Protein From Mycob 1e-06
>pdb|3O1Z|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) Double Cysteine Mutant From Rabbit Length = 126 Back     alignment and structure 
Iteration: 1

 Score =  126 bits (317), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 78/112 (69%), Gaps = 2/112 (1%)
Query: 79  TIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDIL 138
           TIF KII KEIP+ I++ED++ LAF DI+PQAP H L+IPK    ++ ++ AE     +L
Sbjct: 17  TIFGKIIRKEIPAKIIFEDDQALAFHDISPQAPTHFLVIPKKH--ISQISAAEDADESLL 74
Query: 139 GHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG 190
           GHL+   K  A   G+  G+R+V+N G    QSVYH+HLHVLGGRQ+ WPPG
Sbjct: 75  GHLMIVGKKAAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126
>pdb|3O1X|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C84a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|3O1C|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C38a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|1RZY|A Chain A, Crystal Structure Of Rabbit Hint Complexed With N- Ethylsulfamoyladenosine Length = 126 Back     alignment and structure
>pdb|3RHN|A Chain A, Histidine Triad Nucleotide-Binding Protein (Hint) From Rabbit Complexed With Gmp Length = 115 Back     alignment and structure
>pdb|4EQE|A Chain A, Crystal Structure Of Histidine Triad Nucleotide-Binding Protein 1 (Hint1) From Human Complexed With Lys-Ams Length = 128 Back     alignment and structure
>pdb|3TW2|A Chain A, High Resolution Structure Of Human Histidine Triad Nucleotide-binding Protein 1 (hhint1)/amp Complex In A Monoclinic Space Group Length = 126 Back     alignment and structure
>pdb|1KPA|A Chain A, Pkci-1-Zinc Length = 126 Back     alignment and structure
>pdb|1KPB|A Chain A, Pkci-1-Apo Length = 125 Back     alignment and structure
>pdb|3N1S|A Chain A, Crystal Structure Of Wild Type Echint Gmp Complex Length = 119 Back     alignment and structure
>pdb|3OJ7|A Chain A, Crystal Structure Of A Histidine Triad Family Protein From Entamoeba Histolytica, Bound To Sulfate Length = 117 Back     alignment and structure
>pdb|3N1T|A Chain A, Crystal Structure Of The H101a Mutant Echint Gmp Complex Length = 119 Back     alignment and structure
>pdb|1XQU|A Chain A, Hit Family Hydrolase From Clostridium Thermocellum Cth-393 Length = 147 Back     alignment and structure
>pdb|4EGU|A Chain A, 0.95a Resolution Structure Of A Histidine Triad Protein From Clostridium Difficile Length = 119 Back     alignment and structure
>pdb|3LB5|A Chain A, Crystal Structure Of Hit-Like Protein Involved In Cell-Cycle Regulation From Bartonella Henselae With Unknown Ligand Length = 161 Back     alignment and structure
>pdb|3L7X|A Chain A, The Crystal Structure Of Smu.412c From Streptococcus Mutans Ua159 Length = 173 Back     alignment and structure
>pdb|1Y23|A Chain A, Crystal Structure Of A Member Of Hit Family Of Proteins From Bacillus Subtilis Length = 145 Back     alignment and structure
>pdb|3KSV|A Chain A, Hypothetical Protein From Leishmania Major Length = 149 Back     alignment and structure
>pdb|3IMI|A Chain A, 2.01 Angstrom Resolution Crystal Structure Of A Hit Family Protein From Bacillus Anthracis Str. 'ames Ancestor' Length = 147 Back     alignment and structure
>pdb|3O0M|A Chain A, Crystal Structure Of A Zn-Bound Histidine Triad Family Protein From Mycobacterium Smegmatis Length = 149 Back     alignment and structure
>pdb|2EO4|A Chain A, Crystal Structure Of Hypothetical Histidine Triad Nucleotide-Binding Protein St2152 From Sulfolobus Tokodaii Strain7 Length = 149 Back     alignment and structure
>pdb|3P0T|A Chain A, Crystal Structure Of An Hit-Like Protein From Mycobacterium Paratuberculosis Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 1e-70
3oj7_A117 Putative histidine triad family protein; hydrolase 5e-64
4egu_A119 Histidine triad (HIT) protein; structural genomics 2e-63
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 1e-60
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 6e-60
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 3e-54
3ksv_A149 Uncharacterized protein; HIT family, structural ge 2e-52
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 6e-48
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 2e-47
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 5e-47
3imi_A147 HIT family protein; structural genomics, infectiou 6e-47
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 3e-46
2eo4_A149 150AA long hypothetical histidine triad nucleotid 2e-45
3r6f_A135 HIT family protein; structural genomics, seattle s 1e-38
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 3e-31
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 2e-17
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 6e-14
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 2e-07
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 2e-05
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 5e-04
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 7e-04
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
 Score =  208 bits (533), Expect = 1e-70
 Identities = 62/124 (50%), Positives = 81/124 (65%), Gaps = 2/124 (1%)

Query: 67  KAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTT 126
            A A  A     TIF KII KEIP+ I++ED++ LAF DI+PQAP H L+IPK    ++ 
Sbjct: 5   IAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQALAFHDISPQAPTHFLVIPKKH--ISQ 62

Query: 127 LAKAEARHGDILGHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLK 186
           ++ AE     +LGHL+   K  A   G+  G+R+V+N G    QSVYH+HLHVLGGRQ+ 
Sbjct: 63  ISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMN 122

Query: 187 WPPG 190
           WPPG
Sbjct: 123 WPPG 126
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Length = 119 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} Length = 149 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Length = 161 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Length = 138 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} Length = 147 Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Length = 173 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Length = 135 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Length = 147 Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Length = 218 Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Length = 154 Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Length = 440 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Length = 348 Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 100.0
3oj7_A117 Putative histidine triad family protein; hydrolase 100.0
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 100.0
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 100.0
4egu_A119 Histidine triad (HIT) protein; structural genomics 100.0
3ksv_A149 Uncharacterized protein; HIT family, structural ge 99.97
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 99.97
3imi_A147 HIT family protein; structural genomics, infectiou 99.97
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 99.97
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 99.96
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 99.96
3r6f_A135 HIT family protein; structural genomics, seattle s 99.96
2eo4_A149 150AA long hypothetical histidine triad nucleotid 99.96
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 99.95
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 99.95
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 99.93
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 99.92
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 99.92
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 99.92
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 99.91
3ohe_A137 Histidine triad (HIT) protein; structural genomics 99.8
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 99.78
3nrd_A135 Histidine triad (HIT) protein; structural genomics 99.71
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 99.68
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 99.65
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 99.16
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 99.11
1z84_A 351 Galactose-1-phosphate uridyl transferase-like prot 98.37
2pof_A227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 96.74
1gup_A 348 Galactose-1-phosphate uridylyltransferase; nucleot 94.91
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
Probab=100.00  E-value=5e-40  Score=251.40  Aligned_cols=124  Identities=52%  Similarity=0.915  Sum_probs=107.9

Q ss_pred             hHHHHHHHHHHhcCCCCCceeheecccccCccEEEEcCeEEEEeeCCCCCCeEEEEEeecCCCCCCchhhhhhHHHHHHH
Q 029617           61 DEEAAAKAAALNAGSEAPTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGH  140 (190)
Q Consensus        61 ~e~~~a~~~~~~~~~~~~CiFC~Ii~~e~p~~IVyEde~~vaf~d~~P~~pgHvLVIPKrH~~l~dL~~l~~~~~~~L~~  140 (190)
                      +|+.+|+++   + .+++|+||+|+++|++.++|||||+++||.|++|.+|||+|||||+|  +.++.++++++.+++++
T Consensus         3 ~~~~~~~~~---~-~~~~CiFC~i~~~e~~~~iv~e~e~~~af~d~~P~~pgH~LViPk~H--~~~l~dL~~~e~~~l~~   76 (126)
T 3o1c_A            3 DEIAKAQVA---R-PGGDTIFGKIIRKEIPAKIIFEDDQALAFHDISPQAPTHFLVIPKKH--ISQISAAEDADESLLGH   76 (126)
T ss_dssp             ------------C-TTCSSHHHHHHHTSSCCCEEEECSSEEEEECSSCSSSEEEEEEESSC--CCCGGGCCGGGHHHHHH
T ss_pred             chhhccccc---C-CCCCCCcchhhcCCCcCCEEEECCCEEEEECCCCCCCceEEEEechH--hchHhhCchhHHHHHHH
Confidence            577777777   3 58899999999999999999999999999999999999999999999  67777777788889999


Q ss_pred             HHHHHHHHHHHhCCCCCeEEEEecCCCCCCccceEEEEEEcCCCCCCCCC
Q 029617          141 LLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG  190 (190)
Q Consensus       141 ll~~ak~v~~~~~~~~gyni~in~G~~agqsV~HlHlHVIPR~~~~wp~~  190 (190)
                      ++..+++++++++.++|||+++|+|+.+||+|+|+|+|||||++|+||||
T Consensus        77 l~~~~~~~~~~~~~~~g~ni~~n~g~~agq~v~HlH~Hiipr~~~~~~~~  126 (126)
T 3o1c_A           77 LMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG  126 (126)
T ss_dssp             HHHHHHHHHHHTTCTTCEEEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             HHHHHHHHHHHhCCCCCeEEEEecCCccCCccCEeEEEEeCCcccCCCCC
Confidence            99999999999887789999999999999999999999999999999998
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 8e-41
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium ther 1e-30
d1y23a_139 d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423] 4e-25
d1emsa1160 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-te 2e-24
d1fita_146 d.13.1.1 (A:) FHIT (fragile histidine triad protei 7e-17
d1guqa2171 d.13.1.2 (A:178-348) Galactose-1-phosphate uridyly 9e-17
d1vlra1192 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C- 9e-17
d1z84a2156 d.13.1.2 (A:196-351) Galactose-1-phosphate uridyly 6e-12
d2oika1139 d.13.1.1 (A:6-144) Histidine triad protein Mfla250 2e-11
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  132 bits (332), Expect = 8e-41
 Identities = 58/112 (51%), Positives = 77/112 (68%), Gaps = 2/112 (1%)

Query: 79  TIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDIL 138
           TIF KII KEIP+ I++ED++ LAF DI+PQAP H L+IPK      ++A+ +     +L
Sbjct: 2   TIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDD--DESLL 59

Query: 139 GHLLCASKIVAEKEGILDGFRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG 190
           GHL+   K  A   G+  G+R+V+N G    QSVYH+HLHVLGGRQ+ WPPG
Sbjct: 60  GHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 111
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Length = 139 Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 192 Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 156 Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 100.0
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 100.0
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 99.97
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 99.96
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 99.94
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 99.94
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 99.92
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 99.92
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 99.51
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 97.62
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escheri 96.58
d2pofa1220 CDP-diacylglycerol pyrophosphatase CDH {Escherichi 96.56
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.6e-39  Score=240.44  Aligned_cols=111  Identities=53%  Similarity=0.978  Sum_probs=103.9

Q ss_pred             CceeheecccccCccEEEEcCeEEEEeeCCCCCCeEEEEEeecCCCCCCchhhhhhHHHHHHHHHHHHHHHHHHhCCCCC
Q 029617           78 PTIFDKIIAKEIPSSIVYEDEKVLAFRDINPQAPVHVLIIPKFRDGLTTLAKAEARHGDILGHLLCASKIVAEKEGILDG  157 (190)
Q Consensus        78 ~CiFC~Ii~~e~p~~IVyEde~~vaf~d~~P~~pgHvLVIPKrH~~l~dL~~l~~~~~~~L~~ll~~ak~v~~~~~~~~g  157 (190)
                      +|+||+|++||.|+.+|||||+++||+|++|.++||+|||||+|  +.++.++++++.+++..++..+++++++.+.++|
T Consensus         1 dCiFc~I~~~e~p~~ivyede~~~af~D~~P~~~gH~LViPk~H--~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~g   78 (111)
T d1kpfa_           1 DTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKH--ISQISVAEDDDESLLGHLMIVGKKCAADLGLNKG   78 (111)
T ss_dssp             CCHHHHHHTTSSCCCEEEECSSEEEEECSSCSSSEEEEEEESSC--CSCGGGCCGGGHHHHHHHHHHHHHHHHHTTCTTC
T ss_pred             CCcccccccCCCCccEEEeCCCEEEEecCCCCCCceEEEeecch--hcchhhhhhHHHHHHHHHHHHHHHHHHHhCCCCC
Confidence            69999999999999999999999999999999999999999999  5666777777778889999999999998877899


Q ss_pred             eEEEEecCCCCCCccceEEEEEEcCCCCCCCCC
Q 029617          158 FRVVINNGPGACQSVYHLHLHVLGGRQLKWPPG  190 (190)
Q Consensus       158 yni~in~G~~agqsV~HlHlHVIPR~~~~wp~~  190 (190)
                      ||+++|+|+.+||+|+|+|+|||||++|+||||
T Consensus        79 ~~i~~n~g~~agq~V~HlH~Hiip~~~l~wppg  111 (111)
T d1kpfa_          79 YRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG  111 (111)
T ss_dssp             EEEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             EEEEEeCCccCCcccceeEEEEeCCCcCCCCcC
Confidence            999999999999999999999999999999998
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure