Citrus Sinensis ID: 029629


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH
cEEEEEEccccccccccccHHHHHHHcccccccEEEEccccccHHHHHHHHHHcccEEEEEcccccccccccEEEEEEccEEEEEEccccccccccHHHHHHHHHHccccEEEEccccCEEEEECccEEEEccccccccccccccccccEEEEEEECccEEEEEEEEEcccCEEEEEEEEECcccccccc
MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFK*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 29 Plays a role in vesicular protein sorting. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. Required for the auxin-carrier protein PIN2 sorting to the lytic vacuolar pathway and the PIN1 recycling to the plasma membrane. Also involved in the efficient sorting of seed storage proteins globulin 12S and albumin 2S. The VPS29-VPS26-VPS35 subcomplex may be involved in recycling of specific cargos from endosome to the plasma membrane.confidentQ9STT2
Vacuolar protein sorting-associated protein 29 Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (igf2r and m6pr) from endosomes to the trans-Golgi network. Has low protein phosphatase activity.probableQ7ZV68
Vacuolar protein sorting-associated protein 29 Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Has low protein phosphatase activity towards a serine-phosphorylated peptide derived from IGF2R (in vitro).probableQ5R9Z1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.3Phosphoserine phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z2W, chain A
Confidence level:very confident
Coverage over the Query: 2-183
View the alignment between query and template
View the model in PyMOL