Citrus Sinensis ID: 029629

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH
cEEEEEEcccccccccccHHHHHHHHcccccccEEEEccccccHHHHHHHHHHcccEEEEEcccccccccccEEEEEEccEEEEEEccccccccccHHHHHHHHHHccccEEEEccccEEEEEEEccEEEEccccccccccccccccccEEEEEEEEccEEEEEEEEEcccEEEEEEEEEEEcccccccc
cEEEEEEEcccccccHHccHHHHHHHHccccccEEEEEcccccHHHHHHHHHHcccEEEEEcccccccccccEEEEEEccEEEEEEcccEEEccccHHHHHHHHHHcccEEEEEccccccEEEEcccEEEEccccccccccccccccccEEEEEEEcccEEEEEEEEEEcccEEEEEEEEEcccccEEcc
MVLVLAIgdlhiphrasdlpqkfksmlvpgkiqHIICTGNLSIKEVHDYLKSlcpdlhvtrgeydedsrypetktltigqfklgichghqvipwgdlDSLAMLQRQLDVDILVTGHTHqfkaykheggvvinpgsatgayssftfdvnpsfvlmdidgLRVVVYVYELIDgevkvdkidfkktattrlah
MVLVLAIgdlhiphrasdlpqKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTrgeydedsrypeTKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELidgevkvdkidfkktattrlah
MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH
**LVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFK*********
MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKI************
MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH
MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTAT*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATTRLAH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
Q9STT2190 Vacuolar protein sorting- yes no 0.978 0.978 0.870 3e-94
Q7ZV68182 Vacuolar protein sorting- yes no 0.957 1.0 0.631 2e-68
Q5R9Z1182 Vacuolar protein sorting- yes no 0.957 1.0 0.626 5e-68
Q9QZ88182 Vacuolar protein sorting- yes no 0.957 1.0 0.626 6e-68
Q3T0M0186 Vacuolar protein sorting- yes no 0.952 0.973 0.629 8e-68
B2RZ78182 Vacuolar protein sorting- yes no 0.957 1.0 0.626 1e-67
Q9UBQ0182 Vacuolar protein sorting- yes no 0.952 0.994 0.629 2e-67
Q6DEU3182 Vacuolar protein sorting- yes no 0.957 1.0 0.626 3e-67
Q6GP62182 Vacuolar protein sorting- N/A no 0.957 1.0 0.626 3e-67
Q5ZIL2186 Vacuolar protein sorting- yes no 0.952 0.973 0.629 4e-67
>sp|Q9STT2|VPS29_ARATH Vacuolar protein sorting-associated protein 29 OS=Arabidopsis thaliana GN=VPS29 PE=2 SV=1 Back     alignment and function desciption
 Score =  343 bits (881), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 173/186 (93%)

Query: 1   MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVT 60
           MVLVLA+GDLH+PHRA+DLP KFKSMLVPGKIQHIICTGNL IKE+HDYLK++CPDLH+ 
Sbjct: 1   MVLVLALGDLHVPHRAADLPPKFKSMLVPGKIQHIICTGNLCIKEIHDYLKTICPDLHIV 60

Query: 61  RGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQF 120
           RGE+DED+RYPE KTLTIGQFKLG+CHGHQVIPWGDLDSLAMLQRQL VDILVTGHTHQF
Sbjct: 61  RGEFDEDARYPENKTLTIGQFKLGLCHGHQVIPWGDLDSLAMLQRQLGVDILVTGHTHQF 120

Query: 121 KAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDF 180
            AYKHEGGVVINPGSATGAYSS   DVNPSFVLMDIDG R VVYVYELIDGEVKVDKI+F
Sbjct: 121 TAYKHEGGVVINPGSATGAYSSINQDVNPSFVLMDIDGFRAVVYVYELIDGEVKVDKIEF 180

Query: 181 KKTATT 186
           KK  TT
Sbjct: 181 KKPPTT 186
Plays a role in vesicular protein sorting. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. Required for the auxin-carrier protein PIN2 sorting to the lytic vacuolar pathway and the PIN1 recycling to the plasma membrane. Also involved in the efficient sorting of seed storage proteins globulin 12S and albumin 2S. The VPS29-VPS26-VPS35 subcomplex may be involved in recycling of specific cargos from endosome to the plasma membrane.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7ZV68|VPS29_DANRE Vacuolar protein sorting-associated protein 29 OS=Danio rerio GN=vps29 PE=2 SV=1 Back     alignment and function description
>sp|Q5R9Z1|VPS29_PONAB Vacuolar protein sorting-associated protein 29 OS=Pongo abelii GN=VPS29 PE=2 SV=1 Back     alignment and function description
>sp|Q9QZ88|VPS29_MOUSE Vacuolar protein sorting-associated protein 29 OS=Mus musculus GN=Vps29 PE=1 SV=1 Back     alignment and function description
>sp|Q3T0M0|VPS29_BOVIN Vacuolar protein sorting-associated protein 29 OS=Bos taurus GN=VPS29 PE=2 SV=1 Back     alignment and function description
>sp|B2RZ78|VPS29_RAT Vacuolar protein sorting-associated protein 29 OS=Rattus norvegicus GN=Vps29 PE=1 SV=2 Back     alignment and function description
>sp|Q9UBQ0|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 OS=Homo sapiens GN=VPS29 PE=1 SV=1 Back     alignment and function description
>sp|Q6DEU3|VPS29_XENTR Vacuolar protein sorting-associated protein 29 OS=Xenopus tropicalis GN=vps29 PE=2 SV=1 Back     alignment and function description
>sp|Q6GP62|VPS29_XENLA Vacuolar protein sorting-associated protein 29 OS=Xenopus laevis GN=vps29 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIL2|VPS29_CHICK Vacuolar protein sorting-associated protein 29 OS=Gallus gallus GN=VPS29 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
255558184188 Vacuolar protein sorting, putative [Rici 0.984 0.994 0.957 1e-100
225425766190 PREDICTED: vacuolar protein sorting-asso 1.0 1.0 0.942 1e-100
346470445190 hypothetical protein [Amblyomma maculatu 0.994 0.994 0.931 1e-100
115445439188 Os02g0265400 [Oryza sativa Japonica Grou 0.973 0.984 0.940 2e-99
242064710188 hypothetical protein SORBIDRAFT_04g00982 0.973 0.984 0.945 4e-99
255540969191 Vacuolar protein sorting, putative [Rici 1.0 0.994 0.916 1e-98
357141447188 PREDICTED: vacuolar protein sorting-asso 0.973 0.984 0.940 1e-98
226531163188 vacuolar protein sorting 29 [Zea mays] g 0.973 0.984 0.940 2e-98
224114377191 predicted protein [Populus trichocarpa] 1.0 0.994 0.910 3e-98
357462271190 Vacuolar protein sorting [Medicago trunc 1.0 1.0 0.894 3e-98
>gi|255558184|ref|XP_002520119.1| Vacuolar protein sorting, putative [Ricinus communis] gi|223540611|gb|EEF42174.1| Vacuolar protein sorting, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/187 (95%), Positives = 183/187 (97%)

Query: 1   MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVT 60
           MVLVLAIGDLHIPHRA+DLP KFKSMLVPGKIQHIICTGN  IKEVHDYLKSLCPDLH+T
Sbjct: 1   MVLVLAIGDLHIPHRAADLPPKFKSMLVPGKIQHIICTGNPCIKEVHDYLKSLCPDLHIT 60

Query: 61  RGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQF 120
           RGEYDEDS YPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQF
Sbjct: 61  RGEYDEDSCYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQF 120

Query: 121 KAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDF 180
           KAYKHEGGVVINPGSATGAYSSFT+DVNPSFVLMD+DGLRVVVYVYELIDGEVKVDKIDF
Sbjct: 121 KAYKHEGGVVINPGSATGAYSSFTYDVNPSFVLMDVDGLRVVVYVYELIDGEVKVDKIDF 180

Query: 181 KKTATTR 187
           KKTATTR
Sbjct: 181 KKTATTR 187

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225425766|ref|XP_002277517.1| PREDICTED: vacuolar protein sorting-associated protein 29 [Vitis vinifera] gi|296086408|emb|CBI31997.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|346470445|gb|AEO35067.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|115445439|ref|NP_001046499.1| Os02g0265400 [Oryza sativa Japonica Group] gi|50251955|dbj|BAD27890.1| putative vacuolar protein sorting; Vps29p [Oryza sativa Japonica Group] gi|113536030|dbj|BAF08413.1| Os02g0265400 [Oryza sativa Japonica Group] gi|125538892|gb|EAY85287.1| hypothetical protein OsI_06659 [Oryza sativa Indica Group] gi|215701252|dbj|BAG92676.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765582|dbj|BAG87279.1| unnamed protein product [Oryza sativa Japonica Group] gi|222622567|gb|EEE56699.1| hypothetical protein OsJ_06169 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242064710|ref|XP_002453644.1| hypothetical protein SORBIDRAFT_04g009820 [Sorghum bicolor] gi|241933475|gb|EES06620.1| hypothetical protein SORBIDRAFT_04g009820 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|255540969|ref|XP_002511549.1| Vacuolar protein sorting, putative [Ricinus communis] gi|223550664|gb|EEF52151.1| Vacuolar protein sorting, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357141447|ref|XP_003572228.1| PREDICTED: vacuolar protein sorting-associated protein 29-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|226531163|ref|NP_001147749.1| vacuolar protein sorting 29 [Zea mays] gi|195613446|gb|ACG28553.1| vacuolar protein sorting 29 [Zea mays] gi|413925910|gb|AFW65842.1| vacuolar protein sorting 29 [Zea mays] Back     alignment and taxonomy information
>gi|224114377|ref|XP_002316742.1| predicted protein [Populus trichocarpa] gi|222859807|gb|EEE97354.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357462271|ref|XP_003601417.1| Vacuolar protein sorting [Medicago truncatula] gi|355490465|gb|AES71668.1| Vacuolar protein sorting [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
TAIR|locus:2100362190 MAG1 "AT3G47810" [Arabidopsis 0.978 0.978 0.870 2.5e-88
ZFIN|ZDB-GENE-030131-8764182 vps29 "vacuolar protein sortin 0.957 1.0 0.631 3.7e-64
MGI|MGI:1928344182 Vps29 "vacuolar protein sortin 0.957 1.0 0.626 6e-64
UNIPROTKB|G3X6P5185 VPS29 "Vacuolar protein sortin 0.952 0.978 0.629 7.6e-64
UNIPROTKB|Q3T0M0186 VPS29 "Vacuolar protein sortin 0.952 0.973 0.629 7.6e-64
UNIPROTKB|Q9UBQ0182 VPS29 "Vacuolar protein sortin 0.952 0.994 0.629 7.6e-64
UNIPROTKB|F1RNN0186 VPS29 "Uncharacterized protein 0.952 0.973 0.629 7.6e-64
RGD|1308332182 Vps29 "vacuolar protein sortin 0.957 1.0 0.626 7.6e-64
UNIPROTKB|E2R8A2180 VPS29 "Uncharacterized protein 0.947 1.0 0.633 9.7e-64
UNIPROTKB|F8VXU5214 VPS29 "Vacuolar protein sortin 0.947 0.841 0.633 9.7e-64
TAIR|locus:2100362 MAG1 "AT3G47810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 882 (315.5 bits), Expect = 2.5e-88, P = 2.5e-88
 Identities = 162/186 (87%), Positives = 173/186 (93%)

Query:     1 MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVT 60
             MVLVLA+GDLH+PHRA+DLP KFKSMLVPGKIQHIICTGNL IKE+HDYLK++CPDLH+ 
Sbjct:     1 MVLVLALGDLHVPHRAADLPPKFKSMLVPGKIQHIICTGNLCIKEIHDYLKTICPDLHIV 60

Query:    61 RGEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQF 120
             RGE+DED+RYPE KTLTIGQFKLG+CHGHQVIPWGDLDSLAMLQRQL VDILVTGHTHQF
Sbjct:    61 RGEFDEDARYPENKTLTIGQFKLGLCHGHQVIPWGDLDSLAMLQRQLGVDILVTGHTHQF 120

Query:   121 KAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDF 180
              AYKHEGGVVINPGSATGAYSS   DVNPSFVLMDIDG R VVYVYELIDGEVKVDKI+F
Sbjct:   121 TAYKHEGGVVINPGSATGAYSSINQDVNPSFVLMDIDGFRAVVYVYELIDGEVKVDKIEF 180

Query:   181 KKTATT 186
             KK  TT
Sbjct:   181 KKPPTT 186
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IEA
GO:0005771 "multivesicular body" evidence=IDA
GO:0008333 "endosome to lysosome transport" evidence=ISS
GO:0016020 "membrane" evidence=IDA
GO:0030904 "retromer complex" evidence=ISS;IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0006623 "protein targeting to vacuole" evidence=RCA;IMP
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0016192 "vesicle-mediated transport" evidence=RCA
GO:0016197 "endosomal transport" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
GO:0001881 "receptor recycling" evidence=IDA
GO:0007034 "vacuolar transport" evidence=IMP
ZFIN|ZDB-GENE-030131-8764 vps29 "vacuolar protein sorting 29 (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1928344 Vps29 "vacuolar protein sorting 29 (S. pombe)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6P5 VPS29 "Vacuolar protein sorting-associated protein 29" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0M0 VPS29 "Vacuolar protein sorting-associated protein 29" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBQ0 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNN0 VPS29 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1308332 Vps29 "vacuolar protein sorting 29 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8A2 VPS29 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8VXU5 VPS29 "Vacuolar protein sorting-associated protein 29" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7ZV68VPS29_DANRE3, ., 1, ., 3, ., 30.63180.95781.0yesno
Q6GP62VPS29_XENLA3, ., 1, ., 3, ., 30.62630.95781.0N/Ano
Q5R9Z1VPS29_PONAB3, ., 1, ., 3, ., 30.62630.95781.0yesno
Q9QZ88VPS29_MOUSE3, ., 1, ., 3, ., 30.62630.95781.0yesno
B2RZ78VPS29_RAT3, ., 1, ., 3, ., 30.62630.95781.0yesno
Q3T0M0VPS29_BOVIN3, ., 1, ., 3, ., 30.62980.95260.9731yesno
Q9UTI5VPS29_SCHPONo assigned EC number0.45940.95260.9679yesno
Q9STT2VPS29_ARATHNo assigned EC number0.87090.97890.9789yesno
Q54IF7VPS29_DICDI3, ., 1, ., 3, ., 30.58010.95260.9890yesno
Q6DEU3VPS29_XENTR3, ., 1, ., 3, ., 30.62630.95781.0yesno
Q5ZIL2VPS29_CHICK3, ., 1, ., 3, ., 30.62980.95260.9731yesno
Q9UBQ0VPS29_HUMAN3, ., 1, ., 3, ., 30.62980.95260.9945yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.976
3rd Layer3.1.3.30.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
cd07394178 cd07394, MPP_Vps29, Homo sapiens Vps29 and related 1e-120
COG0622172 COG0622, COG0622, Predicted phosphoesterase [Gener 7e-32
TIGR00040158 TIGR00040, yfcE, phosphoesterase, MJ0936 family 1e-27
pfam12850146 pfam12850, Metallophos_2, Calcineurin-like phospho 1e-26
cd00841155 cd00841, MPP_YfcE, Escherichia coli YfcE and relat 6e-17
PRK09453182 PRK09453, PRK09453, phosphodiesterase; Provisional 8e-07
TIGR00024225 TIGR00024, SbcD_rel_arch, putative phosphoesterase 3e-05
>gnl|CDD|163637 cd07394, MPP_Vps29, Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information 
 Score =  336 bits (864), Expect = e-120
 Identities = 124/178 (69%), Positives = 153/178 (85%)

Query: 3   LVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRG 62
           LVL IGDLHIPHRASDLP KFK +LVPGKIQH++CTGNL  KE +DYLK++ PD+H+ RG
Sbjct: 1   LVLVIGDLHIPHRASDLPAKFKKLLVPGKIQHVLCTGNLCSKETYDYLKTIAPDVHIVRG 60

Query: 63  EYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKA 122
           ++DE+  YPETK +T+GQFK+G+ HGHQV+PWGD DSLA LQRQLDVDIL++GHTH+F+A
Sbjct: 61  DFDENLNYPETKVITVGQFKIGLIHGHQVVPWGDPDSLAALQRQLDVDILISGHTHKFEA 120

Query: 123 YKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDF 180
           ++HEG   INPGSATGA+S    +V PSFVLMDI G +VV YVY+LIDGEVKV+KI++
Sbjct: 121 FEHEGKFFINPGSATGAFSPLDPNVIPSFVLMDIQGSKVVTYVYQLIDGEVKVEKIEY 178

Vps29 (vacuolar sorting protein 29), also known as vacuolar membrane protein Pep11, is a subunit of the retromer complex which is responsible for the retrieval of mannose-6-phosphate receptors (MPRs) from the endosomes for retrograde transport back to the Golgi. Vps29 has a phosphoesterase fold that acts as a protein interaction scaffold for retromer complex assembly as well as a phosphatase with specificity for the cytoplasmic tail of the MPR. The retromer includes the following 5 subunits: Vps35, Vps26, Vps29, and a dimer of the sorting nexins Vps5 (Snx1), and Vps17 (Snx2). Vps29 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 178
>gnl|CDD|223695 COG0622, COG0622, Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232794 TIGR00040, yfcE, phosphoesterase, MJ0936 family Back     alignment and domain information
>gnl|CDD|221807 pfam12850, Metallophos_2, Calcineurin-like phosphoesterase superfamily domain Back     alignment and domain information
>gnl|CDD|163617 cd00841, MPP_YfcE, Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|181869 PRK09453, PRK09453, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|129135 TIGR00024, SbcD_rel_arch, putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 100.0
COG0622172 Predicted phosphoesterase [General function predic 100.0
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 100.0
KOG3325183 consensus Membrane coat complex Retromer, subunit 100.0
PRK09453182 phosphodiesterase; Provisional 99.97
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 99.97
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 99.96
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.89
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 99.88
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 99.88
COG2129226 Predicted phosphoesterases, related to the Icc pro 99.87
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 99.87
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 99.86
TIGR00583405 mre11 DNA repair protein (mre11). All proteins in 99.86
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 99.84
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 99.83
COG2908237 Uncharacterized protein conserved in bacteria [Fun 99.83
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 99.82
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 99.81
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 99.8
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 99.78
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 99.78
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.78
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 99.77
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 99.76
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 99.75
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 99.75
PHA02546340 47 endonuclease subunit; Provisional 99.75
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 99.74
PRK11340271 phosphodiesterase YaeI; Provisional 99.73
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 99.72
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 99.72
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 99.71
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 99.7
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 99.69
PRK04036504 DNA polymerase II small subunit; Validated 99.69
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 99.69
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.67
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 99.66
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 99.66
PRK10966 407 exonuclease subunit SbcD; Provisional 99.66
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 99.65
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 99.65
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 99.63
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 99.62
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 99.59
cd00838131 MPP_superfamily metallophosphatase superfamily, me 99.58
COG1409301 Icc Predicted phosphohydrolases [General function 99.58
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 99.57
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 99.56
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 99.56
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 99.51
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 99.5
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 99.48
PLN02533427 probable purple acid phosphatase 99.48
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 99.46
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 99.45
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 99.42
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 99.41
KOG1432379 consensus Predicted DNA repair exonuclease SIA1 [G 99.34
COG1408284 Predicted phosphohydrolases [General function pred 99.34
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 99.33
PTZ00422394 glideosome-associated protein 50; Provisional 99.32
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 99.24
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 99.23
COG1768230 Predicted phosphohydrolase [General function predi 99.23
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 99.19
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 99.19
COG1407235 Predicted ICC-like phosphoesterases [General funct 99.17
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 99.12
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 99.11
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 99.1
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 99.09
KOG2679336 consensus Purple (tartrate-resistant) acid phospha 99.09
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 99.02
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 99.02
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 99.01
PHA02239235 putative protein phosphatase 98.99
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 98.92
TIGR03767496 P_acnes_RR metallophosphoesterase, PPA1498 family. 98.88
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 98.87
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 98.86
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 98.86
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 98.83
KOG1378452 consensus Purple acid phosphatase [Carbohydrate tr 98.82
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 98.81
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 98.75
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 98.71
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 98.7
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 98.69
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 98.69
PTZ00480320 serine/threonine-protein phosphatase; Provisional 98.67
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 98.62
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 98.62
cd07421 304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 98.6
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 98.59
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 98.56
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 98.54
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 98.53
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 98.51
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 98.48
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 98.46
cd07418 377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 98.36
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 98.35
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 98.32
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 98.26
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 98.26
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 98.26
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 98.19
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 98.16
KOG3662 410 consensus Cell division control protein/predicted 98.15
cd08162313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 98.14
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 98.12
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 98.08
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 97.43
KOG2863 456 consensus RNA lariat debranching enzyme [RNA proce 97.33
KOG0374331 consensus Serine/threonine specific protein phosph 97.32
KOG3947305 consensus Phosphoesterases [General function predi 97.26
COG1692266 Calcineurin-like phosphoesterase [General function 97.24
KOG0373306 consensus Serine/threonine specific protein phosph 96.72
KOG0372303 consensus Serine/threonine specific protein phosph 96.67
TIGR03768492 RPA4764 metallophosphoesterase, RPA4764 family. Th 96.44
KOG3770 577 consensus Acid sphingomyelinase and PHM5 phosphate 96.3
KOG3818525 consensus DNA polymerase epsilon, subunit B [Repli 96.2
PF13277253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 96.0
KOG0375 517 consensus Serine-threonine phosphatase 2B, catalyt 95.61
PTZ00235291 DNA polymerase epsilon subunit B; Provisional 95.56
TIGR03768 492 RPA4764 metallophosphoesterase, RPA4764 family. Th 95.54
KOG0371319 consensus Serine/threonine protein phosphatase 2A, 95.31
smart00854239 PGA_cap Bacterial capsule synthesis protein PGA_ca 93.13
KOG4419 602 consensus 5' nucleotidase [Nucleotide transport an 92.37
PHA03008234 hypothetical protein; Provisional 91.15
cd07381239 MPP_CapA CapA and related proteins, metallophospha 90.73
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 89.86
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 89.1
PRK01395104 V-type ATP synthase subunit F; Provisional 88.12
PF06874 640 FBPase_2: Firmicute fructose-1,6-bisphosphatase; I 87.55
PF09423 453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 86.0
KOG2476 528 consensus Uncharacterized conserved protein [Funct 85.02
KOG1625600 consensus DNA polymerase alpha-primase complex, po 82.29
PRK02228100 V-type ATP synthase subunit F; Provisional 81.69
KOG0377 631 consensus Protein serine/threonine phosphatase RDG 80.97
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information 
Probab=100.00  E-value=1.4e-38  Score=237.54  Aligned_cols=178  Identities=70%  Similarity=1.215  Sum_probs=155.4

Q ss_pred             EEEEEeecCCCCCCCChHHHHHhhhCCCCccEEEEcCCCCCHHHHHHHhhhCCcEEEeccCCCCCCCCCcceEEEeCCEE
Q 029629            3 LVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQFK   82 (190)
Q Consensus         3 ri~~iSD~H~~~~~~~~~~~l~~~~~~~~~D~vi~~GDl~~~~~~~~l~~l~~~~~~v~GNHD~~~~~p~~~~~~~~~~~   82 (190)
                      +|+++||||++.+...+.+.+.+++++.++|.|+|+||+++.++++.++++..|+++|+||||....+|....++++|.+
T Consensus         1 ~i~viSDtHl~~~~~~~~~~~~~~~~~~~~d~iih~GDi~~~~~~~~l~~~~~~~~~V~GN~D~~~~lp~~~~~~~~g~~   80 (178)
T cd07394           1 LVLVIGDLHIPHRASDLPAKFKKLLVPGKIQHVLCTGNLCSKETYDYLKTIAPDVHIVRGDFDENLNYPETKVITVGQFK   80 (178)
T ss_pred             CEEEEEecCCCCCchhhHHHHHHHhccCCCCEEEECCCCCCHHHHHHHHhhCCceEEEECCCCccccCCCcEEEEECCEE
Confidence            58999999976554456667888876678999999999999999999988766799999999987788999999999999


Q ss_pred             EEEeeCCccCCCCCHHHHHHHhhccCccEEEeCCCCCcceEEEcCeEEEccCCccCCCCCCCCCCCCeEEEEEEeCCEEE
Q 029629           83 LGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVV  162 (190)
Q Consensus        83 i~~~Hg~~~~~~~~~~~~~~~~~~~~~~~vi~GHtH~~~~~~~~~~~~inpGs~~~~~~~~~~~~~~~~~ll~i~~~~~~  162 (190)
                      ++++||+...++...+.+...+++.++|+++|||||.+.....++++++||||++.++.++++.+.++|++++++++.+.
T Consensus        81 i~l~HG~~~~~~~~~~~~~~~~~~~~~dvii~GHTH~p~~~~~~g~~viNPGSv~~~~~~~~~~~~~syail~~~~~~~~  160 (178)
T cd07394          81 IGLIHGHQVVPWGDPDSLAALQRQLDVDILISGHTHKFEAFEHEGKFFINPGSATGAFSPLDPNVIPSFVLMDIQGSKVV  160 (178)
T ss_pred             EEEEECCcCCCCCCHHHHHHHHHhcCCCEEEECCCCcceEEEECCEEEEECCCCCCCCCCCCCCCCCeEEEEEecCCeEE
Confidence            99999998776666677777777889999999999999999999999999999997765545556789999999999999


Q ss_pred             EEEEEeeCCeEEEEEEEe
Q 029629          163 VYVYELIDGEVKVDKIDF  180 (190)
Q Consensus       163 ~~~~~l~~~~~~~~~~~~  180 (190)
                      ++++.+.++++++++++|
T Consensus       161 ~~~~~l~~~~~~~~~~~~  178 (178)
T cd07394         161 TYVYQLIDGEVKVEKIEY  178 (178)
T ss_pred             EEEEEEECCcEEEEEecC
Confidence            999999999999999875

Vps29 (vacuolar sorting protein 29), also known as vacuolar membrane protein Pep11, is a subunit of the retromer complex which is responsible for the retrieval of mannose-6-phosphate receptors (MPRs) from the endosomes for retrograde transport back to the Golgi. Vps29 has a phosphoesterase fold that acts as a protein interaction scaffold for retromer complex assembly as well as a phosphatase with specificity for the cytoplasmic tail of the MPR. The retromer includes the following 5 subunits: Vps35, Vps26, Vps29, and a dimer of the sorting nexins Vps5 (Snx1), and Vps17 (Snx2). Vps29 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily incl
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>KOG3325 consensus Membrane coat complex Retromer, subunit VPS29/PEP11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] Back     alignment and domain information
>KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG3947 consensus Phosphoesterases [General function prediction only] Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>KOG3770 consensus Acid sphingomyelinase and PHM5 phosphate metabolism protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG3818 consensus DNA polymerase epsilon, subunit B [Replication, recombination and repair] Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>KOG0375 consensus Serine-threonine phosphatase 2B, catalytic subunit [General function prediction only] Back     alignment and domain information
>PTZ00235 DNA polymerase epsilon subunit B; Provisional Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>KOG0371 consensus Serine/threonine protein phosphatase 2A, catalytic subunit [Signal transduction mechanisms] Back     alignment and domain information
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap Back     alignment and domain information
>KOG4419 consensus 5' nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA03008 hypothetical protein; Provisional Back     alignment and domain information
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>PRK01395 V-type ATP synthase subunit F; Provisional Back     alignment and domain information
>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1625 consensus DNA polymerase alpha-primase complex, polymerase-associated subunit B [Replication, recombination and repair] Back     alignment and domain information
>PRK02228 V-type ATP synthase subunit F; Provisional Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1z2w_A192 Crystal Structure Of Mouse Vps29 Complexed With Mn2 7e-69
1w24_A182 Crystal Structure Of Human Vps29 Length = 182 1e-68
2r17_A183 Functional Architecture Of The Retromer Cargo-Recog 1e-65
2a22_A215 Structure Of Vacuolar Protein Sorting 29 From Crypt 4e-44
2kkn_A178 Solution Nmr Structure Of Themotoga Maritima Protei 6e-05
>pdb|1Z2W|A Chain A, Crystal Structure Of Mouse Vps29 Complexed With Mn2+ Length = 192 Back     alignment and structure 
Iteration: 1

 Score =  256 bits (653), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 114/182 (62%), Positives = 149/182 (81%)
Query: 2   VLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTR 61
           +LVL +GDLHIPHR + LP KFK +LVPGKIQHI+CTGNL  KE +DYLK+L  D+H+ R
Sbjct: 11  MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVR 70
Query: 62  GEYDEDSRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFK 121
           G++DE+  YPE K +T+GQFK+G+ HGHQVIPWGD+ SLA+LQRQ DVDIL++GHTH+F+
Sbjct: 71  GDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFE 130
Query: 122 AYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDFK 181
           A++HE    INPGSATGAY++   ++ PSFVLMDI    VV YVY+LI  +VKV++I++K
Sbjct: 131 AFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYK 190
Query: 182 KT 183
           K+
Sbjct: 191 KS 192
>pdb|1W24|A Chain A, Crystal Structure Of Human Vps29 Length = 182 Back     alignment and structure
>pdb|2R17|A Chain A, Functional Architecture Of The Retromer Cargo-Recognition Complex Length = 183 Back     alignment and structure
>pdb|2A22|A Chain A, Structure Of Vacuolar Protein Sorting 29 From Cryptosporidium Parvum Length = 215 Back     alignment and structure
>pdb|2KKN|A Chain A, Solution Nmr Structure Of Themotoga Maritima Protein Tm1076: Northeast Structural Genomics Consortium Target Vt57 Length = 178 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 5e-77
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 4e-73
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 2e-50
3ck2_A176 Conserved uncharacterized protein (predicted phosp 4e-33
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 3e-18
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 3e-16
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 1e-06
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 8e-04
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Length = 215 Back     alignment and structure
 Score =  228 bits (583), Expect = 5e-77
 Identities = 82/189 (43%), Positives = 123/189 (65%), Gaps = 9/189 (4%)

Query: 3   LVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRG 62
           LVL IGDL IP+ A +LP  F+ +L   KI +++CTGN+  +E  + LK++  ++++  G
Sbjct: 27  LVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVYIVSG 86

Query: 63  EYDED---------SRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILV 113
           + D             +PE   + IG+FK+G+ HG+QV+PW D  SL   QR+LD DILV
Sbjct: 87  DLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILV 146

Query: 114 TGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEV 173
           TGHTH+ + ++  G + +NPG+ATGA+S+ T D  PSF+LM + G +VV+YVY+L DG+ 
Sbjct: 147 TGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKVVLYVYDLRDGKT 206

Query: 174 KVDKIDFKK 182
            V   +F K
Sbjct: 207 NVAMSEFSK 215
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Length = 192 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Length = 178 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Length = 176 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Length = 190 Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Length = 208 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Length = 252 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 100.0
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 100.0
3ck2_A176 Conserved uncharacterized protein (predicted phosp 100.0
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 100.0
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.97
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 99.96
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 99.96
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.96
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.94
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.93
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 99.92
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.92
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 99.92
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.92
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 99.89
4fbk_A472 DNA repair and telomere maintenance protein NBS1, 99.89
3t1i_A431 Double-strand break repair protein MRE11A; DNA rep 99.89
4fbw_A417 DNA repair protein RAD32; DNA double-strand break 99.89
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.86
2q8u_A336 Exonuclease, putative; structural genomics, joint 99.86
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 99.83
3tho_B379 Exonuclease, putative; adenosine triphosphate, bac 99.83
2xmo_A443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 99.83
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 99.83
1ute_A313 Protein (II purple acid phosphatase); tartrate res 99.81
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break rep 99.81
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 99.68
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 99.68
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 99.56
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 99.46
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 99.42
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.38
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 99.38
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 99.21
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 99.18
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 99.16
3qfk_A 527 Uncharacterized protein; structural genomics, cent 99.1
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 99.09
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 99.03
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 99.03
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 98.98
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 98.95
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 98.92
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 98.91
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 98.86
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 98.81
3e0j_A476 DNA polymerase subunit delta-2; DNA polymerase del 98.71
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 98.68
3jyf_A339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 98.58
3gve_A341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 98.47
2yeq_A527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 98.43
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 98.43
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 98.28
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 98.28
3flo_A460 DNA polymerase alpha subunit B; protein-protein co 97.86
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 97.72
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 97.67
2d00_A109 V-type ATP synthase subunit F; V-ATPase, CHEY, FRE 90.49
3aon_B115 V-type sodium ATPase subunit G; V-ATPase, coiled-c 90.49
2ov6_A101 V-type ATP synthase subunit F; F subunit, A1AO ATP 83.33
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
Probab=100.00  E-value=1.3e-39  Score=245.04  Aligned_cols=183  Identities=62%  Similarity=1.120  Sum_probs=161.8

Q ss_pred             CeEEEEEeecCCCCCCCChHHHHHhhhCCCCccEEEEcCCCCCHHHHHHHhhhCCcEEEeccCCCCCCCCCcceEEEeCC
Q 029629            1 MVLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQ   80 (190)
Q Consensus         1 Mmri~~iSD~H~~~~~~~~~~~l~~~~~~~~~D~vi~~GDl~~~~~~~~l~~l~~~~~~v~GNHD~~~~~p~~~~~~~~~   80 (190)
                      ||||+++||+|++.....+.+++.+++++.++|.|+++||+++.++++.|+++..|+++|+||||....+|....++.++
T Consensus        10 mm~i~~iSD~H~~~~~~~~~~~l~~~~~~~~~d~ii~~GDl~~~~~~~~l~~~~~~~~~v~GNhD~~~~lp~~~~~~~~~   89 (192)
T 1z2w_A           10 RMLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQ   89 (192)
T ss_dssp             -CEEEEECCCCBTTTCSSCCHHHHTTCCTTSCSEEEECSCCBSHHHHHHHHHHCSEEEECCCTTCCCTTSCSEEEEEETT
T ss_pred             ceEEEEEecCCCCccchhHHHHHHHHhccCCCCEEEEcCCCCCHHHHHHHHhcCCCEEEEcCCcCccccCCcceEEEECC
Confidence            89999999999865444556777777766789999999999999999999998778999999999988899988899999


Q ss_pred             EEEEEeeCCccCCCCCHHHHHHHhhccCccEEEeCCCCCcceEEEcCeEEEccCCccCCCCCCCCCCCCeEEEEEEeCCE
Q 029629           81 FKLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLR  160 (190)
Q Consensus        81 ~~i~~~Hg~~~~~~~~~~~~~~~~~~~~~~~vi~GHtH~~~~~~~~~~~~inpGs~~~~~~~~~~~~~~~~~ll~i~~~~  160 (190)
                      .+|+++||++..++.+.+.+..+++..+++++++||+|.+.....+++.++||||++.++.++.....++|+++++++++
T Consensus        90 ~~i~l~Hg~~~~~~~~~~~l~~~~~~~~~d~vi~GHtH~~~~~~~~~~~~inpGS~~~~~~~~~~~~~~~y~il~~~~~~  169 (192)
T 1z2w_A           90 FKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQAST  169 (192)
T ss_dssp             EEEEEECSCCCCBTTCHHHHHHHHHHHSSSEEECCSSCCCEEEEETTEEEEECCCTTCCCCSSCSCCCCEEEEEEEETTE
T ss_pred             EEEEEECCCcCCCCCCHHHHHHHHHhcCCCEEEECCcCcCccEeECCEEEEECCcccccCCCCCcCCCCcEEEEEEECCE
Confidence            99999999998777777888777777899999999999999888899999999999987655555678999999999999


Q ss_pred             EEEEEEEeeCCeEEEEEEEeecc
Q 029629          161 VVVYVYELIDGEVKVDKIDFKKT  183 (190)
Q Consensus       161 ~~~~~~~l~~~~~~~~~~~~~~~  183 (190)
                      +++++++++.+++.+.++.|+|.
T Consensus       170 ~~~~~~~~~~~~~~v~~~~~~~~  192 (192)
T 1z2w_A          170 VVTYVYQLIGDDVKVERIEYKKS  192 (192)
T ss_dssp             EEEEEEEEETTEEEEEEEEEECC
T ss_pred             EEEEEEEccCCEEEEEEEEEccC
Confidence            99999999999999999999873
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>2d00_A V-type ATP synthase subunit F; V-ATPase, CHEY, FRET, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.149.1.1 PDB: 3a5c_H* 3a5d_H 3j0j_H* Back     alignment and structure
>3aon_B V-type sodium ATPase subunit G; V-ATPase, coiled-coil, alpha/beta fold, hydrol Na(+)-ATPase, NTPA3-NTPB3, NTPC, central AXIS; HET: MSE; 2.00A {Enterococcus hirae} Back     alignment and structure
>2ov6_A V-type ATP synthase subunit F; F subunit, A1AO ATP synthase, hydrolase; NMR {Methanosarcina mazei} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d2a22a1193 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, V 3e-61
d1z2wa1182 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, V 7e-57
d3ck2a1173 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 5e-21
d1su1a_184 d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia 1e-17
d1s3la_165 d.159.1.7 (A:) Putative phosphodiesterase MJ0936 { 3e-17
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Length = 193 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: YfcE-like
domain: Vacuolar protein sorting 29, VPS29
species: Cryptosporidium parvum [TaxId: 5807]

 Score =  186 bits (474), Expect = 3e-61
 Identities = 82/189 (43%), Positives = 123/189 (65%), Gaps = 9/189 (4%)

Query: 3   LVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRG 62
           LVL IGDL IP+ A +LP  F+ +L   KI +++CTGN+  +E  + LK++  ++++  G
Sbjct: 5   LVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVYIVSG 64

Query: 63  EYDED---------SRYPETKTLTIGQFKLGICHGHQVIPWGDLDSLAMLQRQLDVDILV 113
           + D             +PE   + IG+FK+G+ HG+QV+PW D  SL   QR+LD DILV
Sbjct: 65  DLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILV 124

Query: 114 TGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRVVVYVYELIDGEV 173
           TGHTH+ + ++  G + +NPG+ATGA+S+ T D  PSF+LM + G +VV+YVY+L DG+ 
Sbjct: 125 TGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKVVLYVYDLRDGKT 184

Query: 174 KVDKIDFKK 182
            V   +F K
Sbjct: 185 NVAMSEFSK 193
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Length = 173 Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 100.0
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 100.0
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 100.0
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 100.0
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 99.96
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.94
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.92
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.92
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 99.87
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 99.86
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.83
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 99.77
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 99.7
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 99.62
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 99.6
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 99.52
d1usha2 337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 99.06
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 98.64
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 98.54
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 98.51
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 98.48
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 98.46
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 98.39
d1t70a_255 Putative phosphatase DR1281 {Deinococcus radiodura 96.71
d2z06a1252 Hypothetical protein TTHA0625 {Thermus thermophilu 96.56
d1t71a_281 Hypothetical protein MPN349 {Mycoplasma pneumoniae 95.69
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: YfcE-like
domain: Vacuolar protein sorting 29, VPS29
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=2.1e-43  Score=261.82  Aligned_cols=182  Identities=63%  Similarity=1.129  Sum_probs=167.9

Q ss_pred             eEEEEEeecCCCCCCCChHHHHHhhhCCCCccEEEEcCCCCCHHHHHHHhhhCCcEEEeccCCCCCCCCCcceEEEeCCE
Q 029629            2 VLVLAIGDLHIPHRASDLPQKFKSMLVPGKIQHIICTGNLSIKEVHDYLKSLCPDLHVTRGEYDEDSRYPETKTLTIGQF   81 (190)
Q Consensus         2 mri~~iSD~H~~~~~~~~~~~l~~~~~~~~~D~vi~~GDl~~~~~~~~l~~l~~~~~~v~GNHD~~~~~p~~~~~~~~~~   81 (190)
                      |||+++||+|++.+..++.+.+.++++..++|.|+|+||+++.++++.|+++..++++|+||||....+|....+++++.
T Consensus         1 MkI~viSD~H~~~~~~~l~~~~~~~~~~~~~D~Ii~~GDi~~~e~l~~l~~~~~~v~~V~GN~D~~~~~p~~~~~~~~g~   80 (182)
T d1z2wa1           1 MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQF   80 (182)
T ss_dssp             CEEEEECCCCBTTTCSSCCHHHHTTCCTTSCSEEEECSCCBSHHHHHHHHHHCSEEEECCCTTCCCTTSCSEEEEEETTE
T ss_pred             CEEEEEeecCCCCcchhhHHHHHHHhcccCCCEEEEccCccchhhHHHHHhhCCceEEEeCCcCcccccceEEEEEEcCc
Confidence            99999999999876666677888887777899999999999999999999998889999999999999999999999999


Q ss_pred             EEEEeeCCccCCCCCHHHHHHHhhccCccEEEeCCCCCcceEEEcCeEEEccCCccCCCCCCCCCCCCeEEEEEEeCCEE
Q 029629           82 KLGICHGHQVIPWGDLDSLAMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSFTFDVNPSFVLMDIDGLRV  161 (190)
Q Consensus        82 ~i~~~Hg~~~~~~~~~~~~~~~~~~~~~~~vi~GHtH~~~~~~~~~~~~inpGs~~~~~~~~~~~~~~~~~ll~i~~~~~  161 (190)
                      +++++||+...++...+.+.+.++..++|+++|||||.+...+.++++++||||+++|+.+......++|++++++++.+
T Consensus        81 ~i~~~Hg~~~~~~~~~~~l~~~~~~~~~divi~GHTH~p~~~~~~~~~~iNPGSv~~pr~~~~~~~~~syaild~~~~~v  160 (182)
T d1z2wa1          81 KIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNIIPSFVLMDIQASTV  160 (182)
T ss_dssp             EEEEECSCCCCBTTCHHHHHHHHHHHSSSEEECCSSCCCEEEEETTEEEEECCCTTCCCCSSCSCCCCEEEEEEEETTEE
T ss_pred             EEEEEeCCCCCCCCCHHHHHHHHhccCCCEEEECCcCcceEEEECCEEEEeCCCCCCCCCCCCCCCCCEEEEEEEeCCEE
Confidence            99999999988888888888888889999999999999999999999999999999987655556788999999999999


Q ss_pred             EEEEEEeeCCeEEEEEEEeecc
Q 029629          162 VVYVYELIDGEVKVDKIDFKKT  183 (190)
Q Consensus       162 ~~~~~~l~~~~~~~~~~~~~~~  183 (190)
                      +++++++.+++++++.+.|+|.
T Consensus       161 ~~~~~~l~~~~v~~~~~~~~~~  182 (182)
T d1z2wa1         161 VTYVYQLIGDDVKVERIEYKKS  182 (182)
T ss_dssp             EEEEEEEETTEEEEEEEEEECC
T ss_pred             EEEEEEecCCcEEEEEEEEEcC
Confidence            9999999999999999999874
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure