Citrus Sinensis ID: 029640

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190

MAQEISNGNHNSASKPPPTPSPLRFSKFFQSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGMFSFVLKDGIMKLIGELGG

cccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHccccccEEEEccccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEECcccccccccccccccccccccccccccccccHHHHHHHHHHHcc

************************FSKFFQSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGMFSFVLKDGIMKLIGELGG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAQEISNGNHNSASKPPPTPSPLRFSKFFQSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGMFSFVLKDGIMKLIGELGG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-glucuronic acid decarboxylase 1	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose. Necessary for the biosynthesis of the core tetrasaccharide in glycosaminoglycan biosynthesis.	probable	Q5PQX0
UDP-glucuronic acid decarboxylase 1	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose. Necessary for the biosynthesis of the core tetrasaccharide in glycosaminoglycan biosynthesis.	probable	Q5R885
UDP-glucuronic acid decarboxylase 1	Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose. Necessary for the biosynthesis of the core tetrasaccharide in glycosaminoglycan biosynthesis.	probable	Q8NBZ7

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B69, chain A
Confidence level:very confident
Coverage over the Query: 32-188
View the alignment between query and template
View the model in PyMOL