Citrus Sinensis ID: 029655


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MGFRFRNINSMCRTYITRVSSQSNNYYHPIIQCQSLNFQFQNHPSSVCSNQHYLKIPIRWHLGHSHDHHQQLSGKDAENIFRLGLASDVGLAAGKALTGYLSGSTAIIADAAHSISDVVLSSIALWSYKAAKAPKDKEHPYGHGKFETLGALGISSMLLATAGGIAWHALDLLLDLLSASPEVVRPVLGK
ccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccc
***RFRNINSMCRTYITRVSSQSNNYYHPIIQCQSLNFQFQNHPSSVCSNQHYLKIPIRWHLG**********GKDAENIFRLGLASDVGLAAGKALTGYLSGSTAIIADAAHSISDVVLSSIALWSYKAAKAPKDKEHPYGHGKFETLGALGISSMLLATAGGIAWHALDLLLDLLSASPEVVRPVLGK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFRFRNINSMCRTYITRVSSQSNNYYHPIIQCQSLNFQFQNHPSSVCSNQHYLKIPIRWHLGHSHDHHQQLSGKDAENIFRLGLASDVGLAAGKALTGYLSGSTAIIADAAHSISDVVLSSIALWSYKAAKAPKDKEHPYGHGKFETLGALGISSMLLATAGGIAWHALDLLLDLLSASPEVVRPVLGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Metal tolerance protein 2 Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.probableQ10LJ2
Metal tolerance protein C1 Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.probableQ8L725

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H90, chain A
Confidence level:probable
Coverage over the Query: 82-175
View the alignment between query and template
View the model in PyMOL