Citrus Sinensis ID: 029656


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MAQEISNGNHNSASKPPPTPSPLRFSKFFQSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGMFSFVLKDGIMKLIGELGG
cccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHccccccEEEEccccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEECcccccccccccccccccccccccccccccccHHHHHHHHHHHcc
************************FSKFFQSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGMFSFVLKDGIMKLIGELGG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQEISNGNHNSASKPPPTPSPLRFSKFFQSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGMFSFVLKDGIMKLIGELGG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-glucuronic acid decarboxylase 1 Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose. Necessary for the biosynthesis of the core tetrasaccharide in glycosaminoglycan biosynthesis.probableQ5PQX0
UDP-glucuronic acid decarboxylase 1 Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose. Necessary for the biosynthesis of the core tetrasaccharide in glycosaminoglycan biosynthesis.probableQ5R885
UDP-glucuronic acid decarboxylase 1 Catalyzes the NAD-dependent decarboxylation of UDP-glucuronic acid to UDP-xylose. Necessary for the biosynthesis of the core tetrasaccharide in glycosaminoglycan biosynthesis.probableQ8NBZ7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B69, chain A
Confidence level:very confident
Coverage over the Query: 32-171
View the alignment between query and template
View the model in PyMOL
Template: 2Q1S, chain A
Confidence level:confident
Coverage over the Query: 26-147,162-188
View the alignment between query and template
View the model in PyMOL