Citrus Sinensis ID: 029687

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MACGALSLTIPLWSHLTSKFDSKRERAFKHQPTTLGIACSNSSPDLPATTEKLQNDASVTGGAYDFGRATKSLTQKLISYPKKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNEIYGEQLGRLGRRSC
ccccccEEHHHHHHHHHccccccccccccccccccEEEEEccccccccHHHHHcccccccccccccccccccccccccccccEEEEEEccccHHHHccccccccccccccHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHccccccEEccccccccccccccccHHHHHHHHHHHHcccc
cEEEEEEEEccccccccccccccccEEEEEEccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccHcHccccccccccccccHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHcccccEEEcHHHHEEccccHcccccccccccccccccccc
macgalsltiplwshltskfdskrerafkhqpttlgiacsnsspdlpatteklqndasvtggaydfgRATKSLTQKLISYPKKVTLVRHGlsswndegrvqgssnlsVLTEAGVRQAERCRKALRNIyfdqcfsspicraksTAEIlwqgrdeplAFIDSLKEAHLFFLEGMKNEIYGeqlgrlgrrsc
macgalsltiplwshltsKFDSKRERAFKHqpttlgiacsnsSPDLPATTEKLQNDASVTGGAYDFGRATKSLTQKLISYPKKVTLVRHGLsswndegrvqgssnlsvlTEAGVRQAERCRKALRNIYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNeiygeqlgrlgrrsc
MACGALSLTIPLWSHLTSKFDSKRERAFKHQPTTLGIACSNSSPDLPATTEKLQNDASVTGGAYDFGRATKSLTQKLISYPKKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNEIYGEQLGRLGRRSC
***GALSLTIPLWSHLTS******************************************GGAYDFGRATKSLTQKLISYPKKVTLVRHGLSSWNDEG*V****NLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNEIYGE**********
***GALSLTIPLWSHLTSK****R**AFKHQPTTLGIACSNSS**************************************KKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNEIYGEQLGRLGRRSC
MACGALSLTIPLWSHLTSKFDSKRERAFKHQPTTLGIACSNSSPDLPATTEKLQNDASVTGGAYDFGRATKSLTQKLISYPKKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNEIYGEQLGRLGRRSC
MACGALSLTIPLWSHLTSKFDSKRERAFKHQPTTLGIACSNS**************************ATKSLTQKLISYPKKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNEIYG*QLG*L*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACGALSLTIPLWSHLTSKFDSKRERAFKHQPTTLGIACSNSSPDLPATTEKLQNDASVTGGAYDFGRATKSLTQKLISYPKKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNEIYGEQLGRLGRRSC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
O07617193 Uncharacterized phosphata yes no 0.465 0.455 0.359 9e-08
B9L9H5 229 2,3-bisphosphoglycerate-d yes no 0.544 0.449 0.376 4e-07
Q29RA5 256 Probable fructose-2,6-bis yes no 0.338 0.25 0.406 6e-07
Q57G26 215 Probable phosphoglycerate yes no 0.460 0.404 0.386 7e-07
A7MIJ0 215 Probable phosphoglycerate yes no 0.460 0.404 0.375 8e-07
Q7NJF7 219 2,3-bisphosphoglycerate-d no no 0.550 0.474 0.348 8e-07
B5BAL1 215 Probable phosphoglycerate yes no 0.460 0.404 0.386 9e-07
B2KBU4 248 2,3-bisphosphoglycerate-d yes no 0.550 0.419 0.338 9e-07
Q8ZJU8 215 Probable phosphoglycerate yes no 0.460 0.404 0.386 9e-07
B4TU55 215 Probable phosphoglycerate yes no 0.460 0.404 0.386 9e-07
>sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 84  VTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKST 143
           V LVRHG + WN + + QG +++  L   G RQA    + +++  +D   +SP+ RAK T
Sbjct: 4   VCLVRHGETDWNLQQKCQGKTDIP-LNATGERQARETGEYVKDFSWDIIVTSPLKRAKRT 62

Query: 144 AEILWQGRDEPLAFIDSLKEAHLFFLEGM 172
           AEI+ +    P+  +D  KE      EGM
Sbjct: 63  AEIINEYLHLPIVEMDDFKERDYGDAEGM 91
Phosphatase with broad substrate specificity. Does not have phosphoglycerate mutase activity.
Bacillus subtilis (strain 168) (taxid: 224308)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: -
>sp|B9L9H5|GPMA_NAUPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|Q29RA5|TIGRA_DANRE Probable fructose-2,6-bisphosphatase TIGAR A OS=Danio rerio GN=tigara PE=2 SV=1 Back     alignment and function description
>sp|Q57G26|GPMB_SALCH Probable phosphoglycerate mutase GpmB OS=Salmonella choleraesuis (strain SC-B67) GN=gpmB PE=3 SV=1 Back     alignment and function description
>sp|A7MIJ0|GPMB_CROS8 Probable phosphoglycerate mutase GpmB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmB PE=3 SV=1 Back     alignment and function description
>sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 Back     alignment and function description
>sp|B5BAL1|GPMB_SALPK Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmB PE=3 SV=1 Back     alignment and function description
>sp|B2KBU4|GPMA_ELUMP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Elusimicrobium minutum (strain Pei191) GN=gpmA PE=3 SV=1 Back     alignment and function description
>sp|Q8ZJU8|GPMB_SALTY Probable phosphoglycerate mutase GpmB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmB PE=3 SV=1 Back     alignment and function description
>sp|B4TU55|GPMB_SALSV Probable phosphoglycerate mutase GpmB OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
255556055287 phosphoglycerate mutase, putative [Ricin 0.904 0.595 0.668 1e-59
224125328241 predicted protein [Populus trichocarpa] 0.661 0.518 0.808 6e-55
359496158233 PREDICTED: probable phosphoglycerate mut 0.624 0.506 0.830 8e-53
297735987231 unnamed protein product [Vitis vinifera] 0.613 0.502 0.827 8e-52
449457733 294 PREDICTED: probable phosphoglycerate mut 0.730 0.469 0.702 3e-51
356549333284 PREDICTED: probable phosphoglycerate mut 0.761 0.507 0.62 5e-45
115435550 303 Os01g0237100 [Oryza sativa Japonica Grou 0.693 0.432 0.661 1e-44
218187836 303 hypothetical protein OsI_01070 [Oryza sa 0.693 0.432 0.661 1e-44
242051451 303 hypothetical protein SORBIDRAFT_03g00047 0.851 0.531 0.572 3e-43
356557683279 PREDICTED: 2,3-bisphosphoglycerate-depen 0.708 0.480 0.581 2e-39
>gi|255556055|ref|XP_002519062.1| phosphoglycerate mutase, putative [Ricinus communis] gi|223541725|gb|EEF43273.1| phosphoglycerate mutase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 117/175 (66%), Positives = 137/175 (78%), Gaps = 4/175 (2%)

Query: 1   MACGALSLTIPL-WSHLTSKFDSKRERAFKHQPTTLGIACSNSSPDLPATTEKLQNDASV 59
           M  G LS   P+ +S L S  +S+R   +    T LGI CSN SPD+P+ TE L NDAS+
Sbjct: 1   MVIGVLSFKAPVHYSSLNSISNSRRPVKYH---TKLGIQCSNFSPDMPSATEMLLNDASI 57

Query: 60  TGGAYDFGRATKSLTQKLISYPKKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAER 119
           TGGAY F  AT SLTQKL+S  KKVTLVRHGLSSWN EGRVQGSSNLSVLT+ GVRQAE 
Sbjct: 58  TGGAYGFESATTSLTQKLLSSSKKVTLVRHGLSSWNLEGRVQGSSNLSVLTDTGVRQAEM 117

Query: 120 CRKALRNIYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKN 174
           CR+AL  I+FD+CFSSPI RAK+TAE++WQ R+EPL F+DSLKEAHL+FLEGM+N
Sbjct: 118 CRQALVKIHFDRCFSSPISRAKTTAEVIWQEREEPLVFLDSLKEAHLYFLEGMRN 172

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125328|ref|XP_002329778.1| predicted protein [Populus trichocarpa] gi|222870840|gb|EEF07971.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359496158|ref|XP_002262974.2| PREDICTED: probable phosphoglycerate mutase gpmB-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735987|emb|CBI23961.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457733|ref|XP_004146602.1| PREDICTED: probable phosphoglycerate mutase GpmB-like [Cucumis sativus] gi|449508904|ref|XP_004163440.1| PREDICTED: probable phosphoglycerate mutase GpmB-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356549333|ref|XP_003543048.1| PREDICTED: probable phosphoglycerate mutase gpmB-like [Glycine max] Back     alignment and taxonomy information
>gi|115435550|ref|NP_001042533.1| Os01g0237100 [Oryza sativa Japonica Group] gi|56783864|dbj|BAD81276.1| phosphoglycerate mutase -like [Oryza sativa Japonica Group] gi|56784099|dbj|BAD81470.1| phosphoglycerate mutase -like [Oryza sativa Japonica Group] gi|113532064|dbj|BAF04447.1| Os01g0237100 [Oryza sativa Japonica Group] gi|215686371|dbj|BAG87632.1| unnamed protein product [Oryza sativa Japonica Group] gi|215697064|dbj|BAG91058.1| unnamed protein product [Oryza sativa Japonica Group] gi|222618066|gb|EEE54198.1| hypothetical protein OsJ_01035 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218187836|gb|EEC70263.1| hypothetical protein OsI_01070 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|242051451|ref|XP_002454871.1| hypothetical protein SORBIDRAFT_03g000470 [Sorghum bicolor] gi|241926846|gb|EER99990.1| hypothetical protein SORBIDRAFT_03g000470 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|356557683|ref|XP_003547143.1| PREDICTED: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2162449 482 AT5G22620 [Arabidopsis thalian 0.608 0.238 0.439 2.2e-20
ZFIN|ZDB-GENE-040116-6 255 pgam2 "phosphoglycerate mutase 0.555 0.411 0.339 1.1e-07
TIGR_CMR|DET_1422207 DET_1422 "phosphoglycerate mut 0.476 0.434 0.322 6.4e-07
UNIPROTKB|P15259 253 PGAM2 "Phosphoglycerate mutase 0.555 0.415 0.339 7.2e-07
TIGR_CMR|BA_2044205 BA_2044 "phosphoglycerate muta 0.460 0.424 0.340 8.4e-07
UNIPROTKB|P0A7A2 215 ytjC "predicted phosphoglycera 0.460 0.404 0.363 2.2e-06
UNIPROTKB|F1N2F2 253 PGAM2 "Phosphoglycerate mutase 0.555 0.415 0.330 2.7e-06
UNIPROTKB|Q32KV0 253 PGAM2 "Phosphoglycerate mutase 0.555 0.415 0.321 2.7e-06
UNIPROTKB|H9GW55 253 PGAM2 "Uncharacterized protein 0.555 0.415 0.330 3.9e-06
ZFIN|ZDB-GENE-060312-25 256 tigara "tp53-induced glycolysi 0.338 0.25 0.406 4e-06
TAIR|locus:2162449 AT5G22620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 247 (92.0 bits), Expect = 2.2e-20, P = 2.2e-20
 Identities = 51/116 (43%), Positives = 75/116 (64%)

Query:    68 RATKSLTQKL-ISYPKKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRN 126
             R++ SL  +  +   K+V LVRHG S+WN+EGR+QGSS+ SVLT+ G  QAE  R+ L +
Sbjct:    33 RSSSSLQDQFTVETTKRVVLVRHGQSTWNEEGRIQGSSDFSVLTKKGESQAEISRQMLID 92

Query:   127 IYFDQCFSSPICRAKSTAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNEIYGEQLG 182
               FD CF+SP+ R+K TAEI+W  R+  + F   L+E  L+  +G+  +   E+ G
Sbjct:    93 DSFDVCFTSPLKRSKKTAEIIWGSRESEMIFDYDLREIDLYSFQGLLKKEGKEKFG 148
GO:0003824 "catalytic activity" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=IDA
ZFIN|ZDB-GENE-040116-6 pgam2 "phosphoglycerate mutase 2 (muscle)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1422 DET_1422 "phosphoglycerate mutase family protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|P15259 PGAM2 "Phosphoglycerate mutase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2044 BA_2044 "phosphoglycerate mutase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P0A7A2 ytjC "predicted phosphoglycerate mutase 2" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2F2 PGAM2 "Phosphoglycerate mutase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q32KV0 PGAM2 "Phosphoglycerate mutase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H9GW55 PGAM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060312-25 tigara "tp53-induced glycolysis and apoptosis regulator a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
pfam00300154 pfam00300, His_Phos_1, Histidine phosphatase super 1e-21
cd07067153 cd07067, HP_PGM_like, Histidine phosphatase domain 2e-19
COG0406208 COG0406, phoE, Broad specificity phosphatase PhoE 2e-18
cd07040153 cd07040, HP, Histidine phosphatase domain found in 2e-17
smart00855158 smart00855, PGAM, Phosphoglycerate mutase family 3e-17
TIGR03162177 TIGR03162, ribazole_cobC, alpha-ribazole phosphata 3e-12
PRK15004199 PRK15004, PRK15004, alpha-ribazole phosphatase; Pr 6e-11
PRK03482 215 PRK03482, PRK03482, phosphoglycerate mutase; Provi 2e-10
TIGR01258 245 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dep 1e-09
PRK13463203 PRK13463, PRK13463, phosphatase PhoE; Provisional 3e-09
COG0588 230 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd 4e-09
PRK14116 228 PRK14116, gpmA, phosphoglyceromutase; Provisional 1e-07
PRK14115 247 PRK14115, gpmA, phosphoglyceromutase; Provisional 8e-07
PRK13462203 PRK13462, PRK13462, acid phosphatase; Provisional 1e-06
PRK14118 227 PRK14118, gpmA, phosphoglyceromutase; Provisional 4e-06
TIGR03848 204 TIGR03848, MSMEG_4193, probable phosphomutase, MSM 5e-06
PRK14119 228 PRK14119, gpmA, phosphoglyceromutase; Provisional 4e-05
PRK07238372 PRK07238, PRK07238, bifunctional RNase H/acid phos 9e-05
COG2062163 COG2062, SixA, Phosphohistidine phosphatase SixA [ 1e-04
PRK01295206 PRK01295, PRK01295, phosphoglyceromutase; Provisio 1e-04
PRK01112 228 PRK01112, PRK01112, phosphoglyceromutase; Provisio 2e-04
PTZ00122299 PTZ00122, PTZ00122, phosphoglycerate mutase; Provi 2e-04
PRK14117 230 PRK14117, gpmA, phosphoglyceromutase; Provisional 4e-04
PTZ00123 236 PTZ00123, PTZ00123, phosphoglycerate mutase like-p 4e-04
PRK14120 249 PRK14120, gpmA, phosphoglyceromutase; Provisional 0.002
>gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) Back     alignment and domain information 
 Score = 86.0 bits (213), Expect = 1e-21
 Identities = 37/98 (37%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 83  KVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKS 142
           ++ LVRHG + WN   R+QG ++ S LTE G  QA    K L+ I FD+ +SSP+ RA  
Sbjct: 1   RLYLVRHGETEWN-VERLQGDTD-SPLTELGREQARALGKRLKGIPFDRIYSSPLLRAIQ 58

Query: 143 TAEILWQGRDEPLAFIDSLKEAHLFFLEGMKNEIYGEQ 180
           TAEIL +    P+     L+E      EG+  +    +
Sbjct: 59  TAEILAEALGLPIIVDPRLRERDFGDWEGLTFDEIKAE 96

The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members. Length = 154
>gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family Back     alignment and domain information
>gnl|CDD|234131 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase Back     alignment and domain information
>gnl|CDD|184966 PRK15004, PRK15004, alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|179583 PRK03482, PRK03482, phosphoglycerate mutase; Provisional Back     alignment and domain information
>gnl|CDD|213596 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>gnl|CDD|172065 PRK13463, PRK13463, phosphatase PhoE; Provisional Back     alignment and domain information
>gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|139587 PRK13462, PRK13462, acid phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|163560 TIGR03848, MSMEG_4193, probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|180903 PRK07238, PRK07238, bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|224973 COG2062, SixA, Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|234902 PRK01112, PRK01112, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|240279 PTZ00122, PTZ00122, phosphoglycerate mutase; Provisional Back     alignment and domain information
>gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|240280 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PRK14116 228 gpmA phosphoglyceromutase; Provisional 99.96
PRK13463203 phosphatase PhoE; Provisional 99.96
PRK15004199 alpha-ribazole phosphatase; Provisional 99.96
PRK14119 228 gpmA phosphoglyceromutase; Provisional 99.96
PRK14117 230 gpmA phosphoglyceromutase; Provisional 99.95
PRK14118 227 gpmA phosphoglyceromutase; Provisional 99.95
PRK01295206 phosphoglyceromutase; Provisional 99.95
PRK01112228 phosphoglyceromutase; Provisional 99.94
PRK14120 249 gpmA phosphoglyceromutase; Provisional 99.94
TIGR03848204 MSMEG_4193 probable phosphomutase, MSMEG_4193 fami 99.94
COG0406208 phoE Broad specificity phosphatase PhoE and relate 99.94
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members 99.94
PRK03482 215 phosphoglycerate mutase; Provisional 99.94
TIGR01258 245 pgm_1 phosphoglycerate mutase, BPG-dependent, fami 99.94
PRK14115 247 gpmA phosphoglyceromutase; Provisional 99.94
PRK13462203 acid phosphatase; Provisional 99.94
PRK07238372 bifunctional RNase H/acid phosphatase; Provisional 99.93
smart00855155 PGAM Phosphoglycerate mutase family. Phosphoglycer 99.92
PF00300158 His_Phos_1: Histidine phosphatase superfamily (bra 99.92
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.9
KOG0235214 consensus Phosphoglycerate mutase [Carbohydrate tr 99.9
PTZ00123 236 phosphoglycerate mutase like-protein; Provisional 99.82
COG0588 230 GpmA Phosphoglycerate mutase 1 [Carbohydrate trans 99.82
cd07067153 HP_PGM_like Histidine phosphatase domain found in 99.75
PTZ00122299 phosphoglycerate mutase; Provisional 99.7
PRK10848159 phosphohistidine phosphatase; Provisional 99.67
COG2062163 SixA Phosphohistidine phosphatase SixA [Signal tra 99.67
TIGR00249152 sixA phosphohistidine phosphatase SixA. 99.67
PRK15416201 lipopolysaccharide core heptose(II)-phosphate phos 99.66
cd07040153 HP Histidine phosphatase domain found in a functio 99.64
PRK06193206 hypothetical protein; Provisional 99.64
KOG4754 248 consensus Predicted phosphoglycerate mutase [Carbo 99.57
KOG0234438 consensus Fructose-6-phosphate 2-kinase/fructose-2 99.35
KOG4609284 consensus Predicted phosphoglycerate mutase [Gener 99.07
KOG3734 272 consensus Predicted phosphoglycerate mutase [Carbo 99.01
cd07061 242 HP_HAP_like Histidine phosphatase domain found in 97.98
PF00328 347 His_Phos_2: Histidine phosphatase superfamily (bra 96.95
PRK10172 436 phosphoanhydride phosphorylase; Provisional 96.24
PRK10173 413 glucose-1-phosphatase/inositol phosphatase; Provis 96.0
KOG3720 411 consensus Lysosomal & prostatic acid phosphatases 95.89
KOG1057 1018 consensus Arp2/3 complex-interacting protein VIP1/ 89.56
>PRK14116 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information 
Probab=99.96  E-value=7.7e-29  Score=203.67  Aligned_cols=107  Identities=28%  Similarity=0.403  Sum_probs=97.1

Q ss_pred             CcEEEEEcCCCCCCCCCCcccCCCCCCCCcHHHHHHHHHHHHHHhc--CCCCEEEECchHHHHHHHHHHHhcCC---CCe
Q 029687           81 PKKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRN--IYFDQCFSSPICRAKSTAEILWQGRD---EPL  155 (189)
Q Consensus        81 ~~~i~LiRHGet~~n~~~~~~g~~d~~pLt~~G~~qA~~~~~~l~~--~~~~~I~sSpl~Ra~qTA~~l~~~~~---~~v  155 (189)
                      |++|||||||+|.+|..++++|+.|. |||+.|++||+.+++.|++  ..++.|||||+.||+|||+++.+..+   +++
T Consensus         1 m~~l~LVRHGeT~~N~~~~~~G~~D~-pLt~~G~~QA~~l~~~L~~~~~~~d~i~sSpL~Ra~qTA~~i~~~~~~~~~~~   79 (228)
T PRK14116          1 MAKLVLIRHGQSEWNLSNQFTGWVDV-DLSEKGVEEAKKAGRLIKEAGLEFDQAYTSVLTRAIKTLHYALEESDQLWIPE   79 (228)
T ss_pred             CCEEEEEeCCCCCCccccCcCCCCCC-CcCHHHHHHHHHHHHHHHhcCCCCCEEEECChHHHHHHHHHHHHhcCcCCCCc
Confidence            47899999999999999999999984 8999999999999999984  68999999999999999999976543   678


Q ss_pred             eecCCcccccCCccCCCCHHHHHHHhHHH-HHhh
Q 029687          156 AFIDSLKEAHLFFLEGMKNEIYGEQLGRL-GRRS  188 (189)
Q Consensus       156 ~~~~~L~E~~~G~~eG~~~~ei~~~~p~~-~~~~  188 (189)
                      .++++|+|++||+|||++++++.+.+|+. +..|
T Consensus        80 ~~~~~LrE~~fG~wEG~~~~ei~~~~p~~~~~~w  113 (228)
T PRK14116         80 TKTWRLNERHYGALQGLNKKETAEKYGDEQVHIW  113 (228)
T ss_pred             ccCcccccccchhhcCCCHHHHHHHhhhhHHHHH
Confidence            89999999999999999999999999986 4444

>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>PRK15004 alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>PRK14119 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14117 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14118 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14120 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>PRK14115 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>smart00855 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0235 consensus Phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PRK10848 phosphohistidine phosphatase; Provisional Back     alignment and domain information
>COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA Back     alignment and domain information
>PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PRK06193 hypothetical protein; Provisional Back     alignment and domain information
>KOG4754 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4609 consensus Predicted phosphoglycerate mutase [General function prediction only] Back     alignment and domain information
>KOG3734 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07061 HP_HAP_like Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PF00328 His_Phos_2: Histidine phosphatase superfamily (branch 2); InterPro: IPR000560 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>PRK10172 phosphoanhydride phosphorylase; Provisional Back     alignment and domain information
>PRK10173 glucose-1-phosphatase/inositol phosphatase; Provisional Back     alignment and domain information
>KOG3720 consensus Lysosomal & prostatic acid phosphatases [Lipid transport and metabolism] Back     alignment and domain information
>KOG1057 consensus Arp2/3 complex-interacting protein VIP1/Asp1, involved in regulation of actin cytoskeleton [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1h2e_A207 Bacillus Stearothermophilus Phoe (Previously Known 1e-07
1ebb_A202 Bacillus Stearothermophilus Yhfr Length = 202 1e-07
2eoa_A177 Structural Study Of Project Id Tthb049 From Thermus 2e-06
2p9z_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-06
2p6o_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-06
2owe_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 3e-06
2p79_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 4e-06
3lnt_A 250 Crystal Structure Of Phosphoglyceromutase From Burk 4e-06
2p9y_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 4e-06
2p30_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 4e-06
2p2z_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 4e-06
2enu_A177 Mutant L121m Structure Of Tthb049 From Thermus Ther 4e-06
2ekb_A177 Structural Study Of Project Id Tthb049 From Thermus 4e-06
1e59_A 249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase C 4e-06
2owd_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 4e-06
1v37_A177 Crystal Structure Of Phosphoglycerate Mutase From T 4e-06
3ezn_A 257 Crystal Structure Of Phosphoglyceromutase From Burk 4e-06
2enw_A177 Mutant Y92h Structure Of Tthb049 From Thermus Therm 4e-06
2p77_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 5e-06
2ekz_A177 Structural Study Of Project Id Tthb049 From Thermus 5e-06
2p9f_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 5e-06
2p78_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 5e-06
2pa0_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 7e-06
2p75_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 7e-06
2p6m_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 7e-06
2p2y_A177 Crystal Structure Of Tthb049 From Thermus Thermophi 7e-06
1xq9_A 258 Structure Of Phosphoglycerate Mutase From Plasmodiu 1e-05
3d8h_A 267 Crystal Structure Of Phosphoglycerate Mutase From C 1e-05
1yfk_A 262 Crystal Structure Of Human B Type Phosphoglycerate 2e-05
3e9c_A 265 Structure Of A Tryptic Core Fragment Of Tigar From 2e-05
3kkk_A 258 Y92c Catalytic Residue Mutant Of Phosphoglycerate M 2e-05
1t8p_A 267 Crystal Structure Of Human Erythrocyte 2,3- Bisphos 4e-05
3dcy_A 275 Crystal Structure A Tp53-Induced Glycolysis And Apo 4e-05
3fdz_B 257 Crystal Structure Of Phosphoglyceromutase From Burk 6e-05
1e58_A 249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase L 6e-05
4emb_A 274 Crystal Structure Of A Phosphoglycerate Mutase Gpma 2e-04
3e9e_A 265 Structure Of Full-Length H11a Mutant Form Of Tigar 3e-04
1fzt_A211 Solution Structure And Dynamics Of An Open B-Sheet, 4e-04
4pgm_A 246 Saccharomyces Cerevisiae Phosphoglycerate Mutase Le 5e-04
1qhf_A 240 Yeast Phosphoglycerate Mutase-3pg Complex Structure 5e-04
>pdb|1H2E|A Chain A, Bacillus Stearothermophilus Phoe (Previously Known As Yhfr) In Complex With Phosphate Length = 207 Back     alignment and structure 
Iteration: 1

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
Query: 86  LVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKSTAE 145
           L RHG + WN E R+QG  + S LTE G + A R  K L  +     ++S   RA  TAE
Sbjct: 6   LTRHGETKWNVERRMQGWQD-SPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRALETAE 64
Query: 146 ILWQGRDEPLAFIDSLKEAHLFFLEGMKNE 175
           I+  GR  P+   + L+E HL   EG  ++
Sbjct: 65  IVRGGRLIPIYQDERLREIHLGDWEGKTHD 94
>pdb|1EBB|A Chain A, Bacillus Stearothermophilus Yhfr Length = 202 Back     alignment and structure
>pdb|2EOA|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (W85h) Length = 177 Back     alignment and structure
>pdb|2P9Z|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2P6O|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2OWE|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2P79|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|3LNT|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound Malonic Acid Length = 250 Back     alignment and structure
>pdb|2P9Y|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2P30|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2P2Z|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2ENU|A Chain A, Mutant L121m Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2EKB|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (L19m) Length = 177 Back     alignment and structure
>pdb|1E59|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Complexed With Vanadate Length = 249 Back     alignment and structure
>pdb|2OWD|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|1V37|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|3EZN|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b Length = 257 Back     alignment and structure
>pdb|2ENW|A Chain A, Mutant Y92h Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2P77|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2EKZ|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (l52m) Length = 177 Back     alignment and structure
>pdb|2P9F|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2P78|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2PA0|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2P75|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2P6M|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|2P2Y|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 Back     alignment and structure
>pdb|1XQ9|A Chain A, Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum At 2.6 Resolution Length = 258 Back     alignment and structure
>pdb|3D8H|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Cryptosporidium Parvum, Cgd7_4270 Length = 267 Back     alignment and structure
>pdb|1YFK|A Chain A, Crystal Structure Of Human B Type Phosphoglycerate Mutase Length = 262 Back     alignment and structure
>pdb|3E9C|A Chain A, Structure Of A Tryptic Core Fragment Of Tigar From Danio Rerio Length = 265 Back     alignment and structure
>pdb|3KKK|A Chain A, Y92c Catalytic Residue Mutant Of Phosphoglycerate Mutase From Plasmodium Falciparum Length = 258 Back     alignment and structure
>pdb|1T8P|A Chain A, Crystal Structure Of Human Erythrocyte 2,3- Bisphosphoglycerate Mutase Length = 267 Back     alignment and structure
>pdb|3DCY|A Chain A, Crystal Structure A Tp53-Induced Glycolysis And Apoptosis Regulator Protein From Homo Sapiens Length = 275 Back     alignment and structure
>pdb|3FDZ|B Chain B, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound 2,3-Diphosphoglyceric Acid And 3- Phosphoglyceric Acid Length = 257 Back     alignment and structure
>pdb|1E58|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Length = 249 Back     alignment and structure
>pdb|4EMB|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpma From Borrelia Burgdorferi B31 Length = 274 Back     alignment and structure
>pdb|3E9E|A Chain A, Structure Of Full-Length H11a Mutant Form Of Tigar From Danio Rerio Length = 265 Back     alignment and structure
>pdb|1FZT|A Chain A, Solution Structure And Dynamics Of An Open B-Sheet, Glycolytic Enzyme-Monomeric 23.7 Kda Phosphoglycerate Mutase From Schizosaccharomyces Pombe Length = 211 Back     alignment and structure
>pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 246 Back     alignment and structure
>pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex Structure To 1.7 A Length = 240 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 8e-28
3e9c_A 265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 2e-25
3r7a_A 237 Phosphoglycerate mutase, putative; structural geno 7e-23
3dcy_A 275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 8e-22
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 1e-19
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 1e-19
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 8e-19
3hjg_A 213 Putative alpha-ribazole-5'-phosphate phosphatase C 4e-18
3f3k_A 265 Uncharacterized protein YKR043C; structural genomi 3e-16
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 2e-15
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 1e-14
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 3e-14
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 1e-13
4emb_A 274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 3e-11
1yfk_A 262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 4e-11
3d8h_A 267 Glycolytic phosphoglycerate mutase; structural gen 1e-10
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 1e-10
1e58_A 249 Phosphoglycerate mutase; phosphohistidine, glycoly 2e-10
3kkk_A 258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 2e-10
3gp3_A 257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 2e-10
1qhf_A 240 Protein (phosphoglycerate mutase); transferase (ph 2e-10
1rii_A 265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 2e-10
2hhj_A 267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 3e-10
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 4e-10
4eo9_A 268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 4e-10
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 6e-09
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 1e-08
3c7t_A 263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 3e-08
3d4i_A 273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 4e-08
3mbk_A 264 Ubiquitin-associated and SH3 domain-containing PR; 3e-06
3fjy_A364 Probable MUTT1 protein; dimer, protein structure i 7e-05
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 Back     alignment and structure
 Score =  102 bits (257), Expect = 8e-28
 Identities = 35/109 (32%), Positives = 50/109 (45%), Gaps = 5/109 (4%)

Query: 83  KVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALRNIYFDQCFSSPICRAKS 142
            + L RHG + WN E R+QG  + S LTE G + A R  K L  +     ++S   RA  
Sbjct: 3   TLYLTRHGETKWNVERRMQGWQD-SPLTEKGRQDAMRLGKRLEAVELAAIYTSTSGRALE 61

Query: 143 TAEILWQGRDEPLAFIDSLKEAHLFFLEGMK----NEIYGEQLGRLGRR 187
           TAEI+  GR  P+   + L+E HL   EG       ++         + 
Sbjct: 62  TAEIVRGGRLIPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQA 110
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Length = 214 Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Length = 202 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Length = 274 Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Length = 267 Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Length = 257 Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Length = 267 Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Length = 173 Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Length = 268 Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Length = 161 Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Length = 172 Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1e58a_ 247 c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia 1e-16
d1qhfa_ 240 c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea 1e-13
d1xq9a_ 241 c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium 2e-12
d1riia_ 243 c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri 3e-12
d1h2ea_207 c.60.1.1 (A:) Broad specificity phosphatase PhoE ( 6e-12
d2hhja1 248 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human 3e-11
d1fzta_211 c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea 4e-11
d1bifa2 219 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc 9e-10
d1v37a_171 c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphat 3e-08
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Escherichia coli [TaxId: 562]

 Score = 73.0 bits (178), Expect = 1e-16
 Identities = 37/116 (31%), Positives = 53/116 (45%), Gaps = 10/116 (8%)

Query: 83  KVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALR--NIYFDQCFSSPICRA 140
           K+ LVRHG S WN E R  G  +   L+E GV +A+   K L+     FD  ++S + RA
Sbjct: 4   KLVLVRHGESQWNKENRFTGWYD-VDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRA 62

Query: 141 KSTAEILWQGRD---EPLAFIDSLKEAHLFFLEGMKN----EIYGEQLGRLGRRSC 189
             T   +    D    P+     L E H   L+G+      E YG++  +  RR  
Sbjct: 63  IHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGF 118
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Length = 207 Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1e58a_ 247 Phosphoglycerate mutase {Escherichia coli [TaxId: 99.97
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillu 99.97
d1riia_ 243 Phosphoglycerate mutase {Mycobacterium tuberculosi 99.96
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosacc 99.95
d1xq9a_ 241 Phosphoglycerate mutase {Plasmodium falciparum [Ta 99.95
d2hhja1 248 Phosphoglycerate mutase {Human (Homo sapiens) [Tax 99.95
d1bifa2 219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.94
d1qhfa_ 240 Phosphoglycerate mutase {Baker's yeast (Saccharomy 99.94
d1v37a_171 Alpha-ribazole-5'-phosphate phosphatase {Thermus t 99.94
d1qwoa_ 435 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 97.75
d1ihpa_ 438 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 97.62
d1nd6a_ 342 Prostatic acid phosphatase {Human (Homo sapiens) [ 97.6
d1dkla_ 409 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 97.46
d1nt4a_ 391 Glucose-1-phosphatase {Escherichia coli [TaxId: 56 97.37
d1qfxa_ 447 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 97.32
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=2.4e-32  Score=180.19  Aligned_cols=108  Identities=31%  Similarity=0.386  Sum_probs=98.9

Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH--CCCCCEEEECCHHHHHHHHHHHHHCCC---CC
Q ss_conf             9928999838878899798613899997896999999999999974--489999997751989999999983289---99
Q 029687           80 YPKKVTLVRHGLSSWNDEGRVQGSSNLSVLTEAGVRQAERCRKALR--NIYFDQCFSSPICRAKSTAEILWQGRD---EP  154 (189)
Q Consensus        80 ~~~~i~LiRHGet~~n~~~~~~g~~d~~pLte~G~~QA~~~~~~l~--~~~~~~I~sSpl~Ra~qTA~~l~~~~~---~~  154 (189)
                      .|++|||||||||.+|..++++|+.| .|||+.|++||+.+++.|+  ++.++.||+||+.||+|||+.+....+   .+
T Consensus         1 ~mtrl~LvRHGeT~~N~~~~~~G~~D-~pLTe~G~~QA~~~~~~L~~~~~~~d~i~sS~L~Ra~~Ta~~i~~~~~~~~~~   79 (247)
T d1e58a_           1 AVTKLVLVRHGESQWNKENRFTGWYD-VDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLP   79 (247)
T ss_dssp             CCEEEEEEECCCBHHHHTTBCCTTCC-CCBCHHHHHHHHHHHHHHHHTTCCCSEEEECSSHHHHHHHHHHHHHHTCTTSC
T ss_pred             CCEEEEEEECCCCHHHHCCCEECCCC-CCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             93399999799883663696618898-98099999999999999996599966202067788898999898640455675


Q ss_pred             EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             0466784123577568999999999869999710
Q 029687          155 LAFIDSLKEAHLFFLEGMKNEIYGEQLGRLGRRS  188 (189)
Q Consensus       155 ~~~~~~L~E~~~G~~eg~~~~ei~~~~p~~~~~~  188 (189)
                      +.++++|+|+++|.|||++..++.+.+|+++.+|
T Consensus        80 i~~~~~L~E~~~G~~eG~~~~ei~~~~~~e~~~~  113 (247)
T d1e58a_          80 VEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQ  113 (247)
T ss_dssp             EEECGGGCCCCCGGGTTCBHHHHHHHHCHHHHHH
T ss_pred             HHEECCHHHCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             2100342014566667985999999857999988
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qwoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]} Back     information, alignment and structure
>d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qfxa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure