Citrus Sinensis ID: 029700
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 189 | ||||||
| 297746468 | 375 | unnamed protein product [Vitis vinifera] | 0.957 | 0.482 | 0.861 | 4e-90 | |
| 225435747 | 365 | PREDICTED: dihydrolipoyllysine-residue a | 0.957 | 0.495 | 0.861 | 5e-90 | |
| 224073158 | 404 | predicted protein [Populus trichocarpa] | 0.962 | 0.450 | 0.824 | 1e-87 | |
| 449514931 | 258 | PREDICTED: LOW QUALITY PROTEIN: haloalka | 0.941 | 0.689 | 0.825 | 3e-85 | |
| 449463857 | 373 | PREDICTED: epoxide hydrolase 4-like [Cuc | 0.941 | 0.477 | 0.820 | 3e-85 | |
| 357488653 | 351 | Haloalkane dehalogenase [Medicago trunca | 0.915 | 0.492 | 0.838 | 1e-84 | |
| 356567443 | 344 | PREDICTED: dihydrolipoyllysine-residue a | 0.957 | 0.526 | 0.801 | 6e-84 | |
| 147838658 | 368 | hypothetical protein VITISV_022866 [Viti | 0.920 | 0.472 | 0.828 | 8e-84 | |
| 125558908 | 381 | hypothetical protein OsI_26591 [Oryza sa | 0.920 | 0.456 | 0.798 | 6e-82 | |
| 388492690 | 178 | unknown [Lotus japonicus] | 0.936 | 0.994 | 0.819 | 6e-82 |
| >gi|297746468|emb|CBI16524.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 335 bits (860), Expect = 4e-90, Method: Compositional matrix adjust.
Identities = 156/181 (86%), Positives = 171/181 (94%)
Query: 1 MEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRN 60
MEP+IC+G++LLNISLRMLHIKKQPWYG+P+IRSFQNLLRNTA G+ FY+ VAT ESV++
Sbjct: 194 MEPQICKGIMLLNISLRMLHIKKQPWYGKPVIRSFQNLLRNTAMGRFFYRSVATPESVKS 253
Query: 61 ILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQVKCPVLIAW 120
ILCQCY+DTSQVTEELV+KIL PGLE GA DVFLEFICYSGGPLPEELLPQVKCPVLIAW
Sbjct: 254 ILCQCYHDTSQVTEELVQKILLPGLEPGAVDVFLEFICYSGGPLPEELLPQVKCPVLIAW 313
Query: 121 GDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVTRHATPPASV 180
GDKDPWEPIELGRAYG FDSVEDFIVLP+VGHCPQDEAP+LVNPLVESFV RHA+P ASV
Sbjct: 314 GDKDPWEPIELGRAYGKFDSVEDFIVLPDVGHCPQDEAPNLVNPLVESFVARHASPKASV 373
Query: 181 S 181
S
Sbjct: 374 S 374
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225435747|ref|XP_002283601.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224073158|ref|XP_002304000.1| predicted protein [Populus trichocarpa] gi|222841432|gb|EEE78979.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449514931|ref|XP_004164518.1| PREDICTED: LOW QUALITY PROTEIN: haloalkane dehalogenase-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449463857|ref|XP_004149647.1| PREDICTED: epoxide hydrolase 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357488653|ref|XP_003614614.1| Haloalkane dehalogenase [Medicago truncatula] gi|355515949|gb|AES97572.1| Haloalkane dehalogenase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356567443|ref|XP_003551929.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147838658|emb|CAN65051.1| hypothetical protein VITISV_022866 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|125558908|gb|EAZ04444.1| hypothetical protein OsI_26591 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|388492690|gb|AFK34411.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 189 | ||||||
| TAIR|locus:2832896 | 359 | AT5G19850 [Arabidopsis thalian | 0.910 | 0.479 | 0.779 | 2.7e-75 | |
| TAIR|locus:2159823 | 374 | AT5G38520 [Arabidopsis thalian | 0.846 | 0.427 | 0.319 | 3.7e-18 | |
| TAIR|locus:2115440 | 378 | AT4G36530 [Arabidopsis thalian | 0.777 | 0.388 | 0.272 | 8.8e-13 | |
| TAIR|locus:2159033 | 484 | PPH "AT5G13800" [Arabidopsis t | 0.666 | 0.260 | 0.270 | 4.3e-07 | |
| TAIR|locus:2103242 | 466 | AT3G10840 [Arabidopsis thalian | 0.640 | 0.259 | 0.311 | 0.00081 |
| TAIR|locus:2832896 AT5G19850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 759 (272.2 bits), Expect = 2.7e-75, P = 2.7e-75
Identities = 134/172 (77%), Positives = 156/172 (90%)
Query: 2 EPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRNI 61
+PEICRG++L+NISLRMLHIKKQP+ GRP I+SFQNLLRNT GKLF+K +A E+V++I
Sbjct: 188 KPEICRGLMLINISLRMLHIKKQPFIGRPFIKSFQNLLRNTPVGKLFFKSIAKPETVKSI 247
Query: 62 LCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQVKCPVLIAWG 121
LCQCY+D+SQVT+ELVE IL+PGLE GA DVFLEFICYSGGPLPE+LLP VKCPVLIAWG
Sbjct: 248 LCQCYHDSSQVTDELVEAILRPGLEPGAVDVFLEFICYSGGPLPEDLLPLVKCPVLIAWG 307
Query: 122 DKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVTRH 173
+KDPWEPIELGRAY NFD+VEDF+VLP+ GHCPQDE P +VNPL+ESFV RH
Sbjct: 308 EKDPWEPIELGRAYSNFDAVEDFVVLPDAGHCPQDEKPEMVNPLIESFVARH 359
|
|
| TAIR|locus:2159823 AT5G38520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115440 AT4G36530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2159033 PPH "AT5G13800" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2103242 AT3G10840 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 189 | |||
| PLN02824 | 294 | PLN02824, PLN02824, hydrolase, alpha/beta fold fam | 1e-125 | |
| PLN02679 | 360 | PLN02679, PLN02679, hydrolase, alpha/beta fold fam | 9e-24 | |
| PLN02578 | 354 | PLN02578, PLN02578, hydrolase | 2e-17 | |
| COG0596 | 282 | COG0596, MhpC, Predicted hydrolases or acyltransfe | 2e-13 | |
| pfam12697 | 187 | pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam | 6e-09 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 3e-07 | |
| pfam00561 | 226 | pfam00561, Abhydrolase_1, alpha/beta hydrolase fol | 3e-05 | |
| pfam12695 | 145 | pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam | 1e-04 | |
| COG0412 | 236 | COG0412, COG0412, Dienelactone hydrolase and relat | 0.004 |
| >gnl|CDD|178419 PLN02824, PLN02824, hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
Score = 355 bits (912), Expect = e-125
Identities = 134/173 (77%), Positives = 151/173 (87%)
Query: 1 MEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRN 60
PE+ RG++L+NISLR LHIKKQPW GRP I++FQNLLR TA GK F+K VAT E+V+N
Sbjct: 122 DAPELVRGVMLINISLRGLHIKKQPWLGRPFIKAFQNLLRETAVGKAFFKSVATPETVKN 181
Query: 61 ILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFICYSGGPLPEELLPQVKCPVLIAW 120
ILCQCY+D S VT+ELVE IL+PGLE GA DVFL+FI YSGGPLPEELLP VKCPVLIAW
Sbjct: 182 ILCQCYHDDSAVTDELVEAILRPGLEPGAVDVFLDFISYSGGPLPEELLPAVKCPVLIAW 241
Query: 121 GDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFVTRH 173
G+KDPWEP+ELGRAY NFD+VEDFIVLP VGHCPQDEAP LVNPL+ESFV RH
Sbjct: 242 GEKDPWEPVELGRAYANFDAVEDFIVLPGVGHCPQDEAPELVNPLIESFVARH 294
|
Length = 294 |
| >gnl|CDD|178283 PLN02679, PLN02679, hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215315 PLN02578, PLN02578, hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family | Back alignment and domain information |
|---|
| >gnl|CDD|223489 COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 189 | |||
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 99.91 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 99.88 | |
| PLN02578 | 354 | hydrolase | 99.81 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 99.8 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 99.76 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 99.75 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 99.74 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 99.73 | |
| KOG4178 | 322 | consensus Soluble epoxide hydrolase [Lipid transpo | 99.71 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 99.69 | |
| PRK07581 | 339 | hypothetical protein; Validated | 99.69 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 99.68 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 99.68 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 99.67 | |
| KOG4409 | 365 | consensus Predicted hydrolase/acyltransferase (alp | 99.66 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 99.66 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 99.66 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 99.65 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 99.65 | |
| KOG2984 | 277 | consensus Predicted hydrolase [General function pr | 99.65 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 99.64 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 99.63 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 99.62 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 99.6 | |
| PLN02965 | 255 | Probable pheophorbidase | 99.6 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 99.58 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 99.57 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 99.55 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 99.52 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 99.52 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.52 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 99.51 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 99.49 | |
| KOG2382 | 315 | consensus Predicted alpha/beta hydrolase [General | 99.48 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 99.45 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 99.44 | |
| KOG2931 | 326 | consensus Differentiation-related gene 1 protein ( | 99.39 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 99.35 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 99.34 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 99.34 | |
| PF03096 | 283 | Ndr: Ndr family; InterPro: IPR004142 This family c | 99.31 | |
| PLN02511 | 388 | hydrolase | 99.28 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 99.21 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 99.2 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 99.16 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 99.14 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 99.12 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 99.12 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 99.11 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 98.93 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 98.86 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 98.85 | |
| PF08386 | 103 | Abhydrolase_4: TAP-like protein; InterPro: IPR0135 | 98.85 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 98.83 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 98.81 | |
| PLN02872 | 395 | triacylglycerol lipase | 98.79 | |
| COG2021 | 368 | MET2 Homoserine acetyltransferase [Amino acid tran | 98.77 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 98.76 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 98.73 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 98.71 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 98.48 | |
| PRK10566 | 249 | esterase; Provisional | 98.47 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 98.44 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 98.41 | |
| KOG1552 | 258 | consensus Predicted alpha/beta hydrolase [General | 98.4 | |
| KOG2551 | 230 | consensus Phospholipase/carboxyhydrolase [Amino ac | 98.26 | |
| KOG4391 | 300 | consensus Predicted alpha/beta hydrolase BEM46 [Ge | 98.2 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 98.19 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 98.16 | |
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 98.16 | |
| KOG4667 | 269 | consensus Predicted esterase [Lipid transport and | 98.15 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 98.14 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 98.12 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 98.08 | |
| PF01738 | 218 | DLH: Dienelactone hydrolase family; InterPro: IPR0 | 98.05 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 97.96 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 97.89 | |
| COG2945 | 210 | Predicted hydrolase of the alpha/beta superfamily | 97.85 | |
| PF08840 | 213 | BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term | 97.74 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 97.72 | |
| PF03959 | 212 | FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 | 97.64 | |
| TIGR01849 | 406 | PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, | 97.54 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 97.53 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 97.52 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 97.33 | |
| COG1073 | 299 | Hydrolases of the alpha/beta superfamily [General | 97.29 | |
| KOG3043 | 242 | consensus Predicted hydrolase related to dienelact | 97.28 | |
| COG0400 | 207 | Predicted esterase [General function prediction on | 97.23 | |
| PF00450 | 415 | Peptidase_S10: Serine carboxypeptidase; InterPro: | 97.22 | |
| PF10142 | 367 | PhoPQ_related: PhoPQ-activated pathogenicity-relat | 97.2 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 97.15 | |
| PLN02213 | 319 | sinapoylglucose-malate O-sinapoyltransferase/ carb | 97.13 | |
| PF09752 | 348 | DUF2048: Uncharacterized conserved protein (DUF204 | 97.11 | |
| PF08538 | 303 | DUF1749: Protein of unknown function (DUF1749); In | 97.04 | |
| PF05705 | 240 | DUF829: Eukaryotic protein of unknown function (DU | 97.01 | |
| PLN02209 | 437 | serine carboxypeptidase | 96.95 | |
| COG3243 | 445 | PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me | 96.88 | |
| KOG3253 | 784 | consensus Predicted alpha/beta hydrolase [General | 96.84 | |
| PF06500 | 411 | DUF1100: Alpha/beta hydrolase of unknown function | 96.81 | |
| KOG1282 | 454 | consensus Serine carboxypeptidases (lysosomal cath | 96.73 | |
| PLN03016 | 433 | sinapoylglucose-malate O-sinapoyltransferase | 96.7 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 96.63 | |
| KOG1838 | 409 | consensus Alpha/beta hydrolase [General function p | 96.51 | |
| PF06850 | 202 | PHB_depo_C: PHB de-polymerase C-terminus; InterPro | 96.49 | |
| PRK05371 | 767 | x-prolyl-dipeptidyl aminopeptidase; Provisional | 96.41 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 96.35 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 96.29 | |
| KOG1551 | 371 | consensus Uncharacterized conserved protein [Funct | 96.15 | |
| COG3571 | 213 | Predicted hydrolase of the alpha/beta-hydrolase fo | 95.93 | |
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 95.76 | |
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 95.56 | |
| PF03583 | 290 | LIP: Secretory lipase ; InterPro: IPR005152 This e | 95.52 | |
| PF11339 | 581 | DUF3141: Protein of unknown function (DUF3141); In | 95.22 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 95.2 | |
| KOG2624 | 403 | consensus Triglyceride lipase-cholesterol esterase | 95.11 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 95.09 | |
| PF06057 | 192 | VirJ: Bacterial virulence protein (VirJ); InterPro | 94.89 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 94.8 | |
| PF02273 | 294 | Acyl_transf_2: Acyl transferase; InterPro: IPR0031 | 94.63 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 94.45 | |
| PRK10115 | 686 | protease 2; Provisional | 94.44 | |
| KOG1515 | 336 | consensus Arylacetamide deacetylase [Defense mecha | 94.38 | |
| PLN00021 | 313 | chlorophyllase | 94.29 | |
| KOG3975 | 301 | consensus Uncharacterized conserved protein [Funct | 94.28 | |
| KOG2565 | 469 | consensus Predicted hydrolases or acyltransferases | 94.15 | |
| KOG4627 | 270 | consensus Kynurenine formamidase [Amino acid trans | 93.71 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 93.2 | |
| COG3458 | 321 | Acetyl esterase (deacetylase) [Secondary metabolit | 92.55 | |
| COG4188 | 365 | Predicted dienelactone hydrolase [General function | 92.19 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 92.08 | |
| COG2939 | 498 | Carboxypeptidase C (cathepsin A) [Amino acid trans | 91.58 | |
| KOG2112 | 206 | consensus Lysophospholipase [Lipid transport and m | 90.85 | |
| COG4287 | 507 | PqaA PhoPQ-activated pathogenicity-related protein | 90.71 | |
| KOG2100 | 755 | consensus Dipeptidyl aminopeptidase [Posttranslati | 90.22 | |
| PF04301 | 213 | DUF452: Protein of unknown function (DUF452); Inte | 87.06 | |
| smart00824 | 212 | PKS_TE Thioesterase. Peptide synthetases are invol | 86.92 | |
| PF07519 | 474 | Tannase: Tannase and feruloyl esterase; InterPro: | 86.65 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 85.68 | |
| PF02129 | 272 | Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam | 84.26 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 83.92 | |
| PF05576 | 448 | Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 | 80.28 |
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
Probab=99.91 E-value=3.4e-23 Score=142.30 Aligned_cols=173 Identities=77% Similarity=1.370 Sum_probs=110.0
Q ss_pred CCcccccceEEeeCchhhhhccCCCCccchhhhhHHHHHhhhhhhHHHHHhhcChHHHHHHHHHhcCCCCCCCHHHHHHH
Q 029700 1 MEPEICRGMILLNISLRMLHIKKQPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRNILCQCYNDTSQVTEELVEKI 80 (189)
Q Consensus 1 ~~P~~v~~lvl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (189)
+||++|++||++++..........+....+....+...+.....+..++........++..+...+.+.....++..+.+
T Consensus 122 ~~p~~v~~lili~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 201 (294)
T PLN02824 122 DAPELVRGVMLINISLRGLHIKKQPWLGRPFIKAFQNLLRETAVGKAFFKSVATPETVKNILCQCYHDDSAVTDELVEAI 201 (294)
T ss_pred hChhheeEEEEECCCcccccccccchhhhHHHHHHHHHHhchhHHHHHHHhhcCHHHHHHHHHHhccChhhccHHHHHHH
Confidence 48999999999998653221111111111122222222222222222222223333444455544554455566666666
Q ss_pred hccCCCCCHHHHHHHHHHhhCCCCccccCCCCCCCeEEEecCCCCCCCchhhhhhcccCCCccEEEcCCCCCCCCCCChh
Q 029700 81 LQPGLETGAADVFLEFICYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPH 160 (189)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~lii~g~~D~~~~~~~~~~~~~~~~~~~~~~l~~~gH~~~~e~p~ 160 (189)
......+.....+..+............+.++++|||+|+|++|.+++.+.++.+++.++++++++++++||++++|+|+
T Consensus 202 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~lvi~G~~D~~~~~~~~~~~~~~~~~~~~~~i~~~gH~~~~e~p~ 281 (294)
T PLN02824 202 LRPGLEPGAVDVFLDFISYSGGPLPEELLPAVKCPVLIAWGEKDPWEPVELGRAYANFDAVEDFIVLPGVGHCPQDEAPE 281 (294)
T ss_pred HhccCCchHHHHHHHHhccccccchHHHHhhcCCCeEEEEecCCCCCChHHHHHHHhcCCccceEEeCCCCCChhhhCHH
Confidence 55444444444444433222222334568899999999999999999999999999988989999999999999999999
Q ss_pred hHHHHHHHHHHhc
Q 029700 161 LVNPLVESFVTRH 173 (189)
Q Consensus 161 ~~~~~i~~fl~~~ 173 (189)
+|++.|.+|++++
T Consensus 282 ~~~~~i~~fl~~~ 294 (294)
T PLN02824 282 LVNPLIESFVARH 294 (294)
T ss_pred HHHHHHHHHHhcC
Confidence 9999999999763
|
|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >KOG2984 consensus Predicted hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4667 consensus Predicted esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family | Back alignment and domain information |
|---|
| >TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0400 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase | Back alignment and domain information |
|---|
| >PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function | Back alignment and domain information |
|---|
| >PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins | Back alignment and domain information |
|---|
| >PLN02209 serine carboxypeptidase | Back alignment and domain information |
|---|
| >COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] | Back alignment and domain information |
|---|
| >KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03016 sinapoylglucose-malate O-sinapoyltransferase | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >KOG1838 consensus Alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06850 PHB_depo_C: PHB de-polymerase C-terminus; InterPro: IPR009656 This entry represents the C terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase | Back alignment and domain information |
|---|
| >PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1551 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases | Back alignment and domain information |
|---|
| >PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >KOG3975 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG4188 Predicted dienelactone hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >smart00824 PKS_TE Thioesterase | Back alignment and domain information |
|---|
| >PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 189 | |||
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 3e-28 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 8e-26 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 2e-18 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 3e-17 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 6e-17 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 7e-16 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 9e-14 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 1e-13 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 2e-13 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 1e-12 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 3e-12 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 6e-12 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 1e-11 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 3e-11 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 5e-11 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 6e-11 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 1e-10 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 1e-10 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 1e-10 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 2e-10 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 2e-10 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 4e-10 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 5e-10 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 7e-10 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 1e-09 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 1e-09 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 2e-09 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 2e-09 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 2e-09 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 4e-09 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 4e-09 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 5e-09 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 5e-09 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 5e-09 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 1e-08 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 2e-08 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 2e-08 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 3e-08 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 3e-08 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 6e-08 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 6e-08 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 8e-08 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 1e-07 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 2e-07 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 3e-07 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 3e-07 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 6e-07 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 1e-06 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 2e-06 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 2e-06 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 2e-06 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 3e-06 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 2e-05 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 3e-05 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 3e-05 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 3e-05 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 3e-05 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 4e-05 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 4e-05 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 1e-04 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 1e-04 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 1e-04 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 1e-04 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 2e-04 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 7e-04 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 8e-04 |
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296 | Back alignment and structure |
|---|
Score = 105 bits (265), Expect = 3e-28
Identities = 22/146 (15%), Positives = 50/146 (34%), Gaps = 8/146 (5%)
Query: 42 TAAGKLFYKMVATSESVRNILCQCYNDTSQVTEELVEKILQPGLETGAADVFLEFI---- 97
+ T E + +++ ND ++ + ++ + ++ +
Sbjct: 147 HEDLRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIR 206
Query: 98 CYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNF--DSVEDFIVLPNVGHCPQ 155
G E + +V+ P L+ G D P+E + + DS ++P+ GH
Sbjct: 207 EQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDS--WGYIIPHCGHWAM 264
Query: 156 DEAPHLVNPLVESFVTRHATPPASVS 181
E P SF++ + +
Sbjct: 265 IEHPEDFANATLSFLSLRVDITPAAA 290
|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Length = 314 | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282 | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Length = 268 | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 1cqw_A 2v9z_A Length = 299 | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Length = 316 | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Length = 276 | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Length = 297 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277 | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Length = 309 | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271 | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293 | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Length = 298 | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273 | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Length = 286 | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Length = 310 | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275 | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Length = 276 | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Length = 328 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Length = 255 | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286 | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Length = 297 | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Length = 279 | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Length = 266 | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330 | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274 | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Length = 301 | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Length = 302 | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Length = 356 | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266 | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Length = 294 | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Length = 304 | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264 | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Length = 207 | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210 | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Length = 306 | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Length = 236 | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Length = 291 | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Length = 293 | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Length = 285 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Length = 241 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 189 | ||||
| d1zd3a2 | 322 | c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, | 9e-14 | |
| d1j1ia_ | 268 | c.69.1.10 (A:) Meta cleavage compound hydrolase Ca | 1e-12 | |
| d2rhwa1 | 283 | c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2 | 2e-11 | |
| d1uk8a_ | 271 | c.69.1.10 (A:) Meta-cleavage product hydrolase Cum | 7e-11 | |
| d1bn7a_ | 291 | c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus | 3e-10 | |
| d1b6ga_ | 310 | c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacte | 1e-09 | |
| d1q0ra_ | 297 | c.69.1.28 (A:) Aclacinomycin methylesterase RdmC { | 4e-09 | |
| d1mtza_ | 290 | c.69.1.7 (A:) Tricorn interacting factor F1 {Archa | 6e-09 | |
| d1qo7a_ | 394 | c.69.1.11 (A:) Bacterial epoxide hydrolase {Asperg | 1e-08 | |
| d1c4xa_ | 281 | c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di | 2e-08 | |
| d1brta_ | 277 | c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au | 4e-08 | |
| d1xkla_ | 258 | c.69.1.20 (A:) Salicylic acid-binding protein 2 (S | 7e-08 | |
| d1azwa_ | 313 | c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas | 7e-08 | |
| d1k8qa_ | 377 | c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari | 9e-08 | |
| d1ehya_ | 293 | c.69.1.11 (A:) Bacterial epoxide hydrolase {Agroba | 1e-07 | |
| d1hkha_ | 279 | c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. | 2e-07 | |
| d1va4a_ | 271 | c.69.1.12 (A:) Arylesterase {Pseudomonas fluoresce | 2e-07 | |
| d1m33a_ | 256 | c.69.1.26 (A:) Biotin biosynthesis protein BioH {E | 2e-07 | |
| d1wm1a_ | 313 | c.69.1.7 (A:) Proline aminopeptidase {Serratia mar | 2e-07 | |
| d1a8sa_ | 273 | c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu | 3e-07 | |
| d1a88a_ | 275 | c.69.1.12 (A:) Chloroperoxidase L {Streptomyces li | 3e-07 | |
| d1pjaa_ | 268 | c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H | 3e-07 | |
| d1mj5a_ | 298 | c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomona | 4e-07 | |
| d3c70a1 | 256 | c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t | 8e-06 | |
| d1r3da_ | 264 | c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio | 2e-05 | |
| d1qlwa_ | 318 | c.69.1.15 (A:) A novel bacterial esterase {Alcalig | 7e-05 | |
| d1imja_ | 208 | c.69.1.23 (A:) Ccg1/TafII250-interacting factor B | 1e-04 | |
| d1a8qa_ | 274 | c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces au | 3e-04 | |
| d2jbwa1 | 360 | c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h | 0.001 |
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Epoxide hydrolase domain: Mammalian epoxide hydrolase, C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 66.1 bits (159), Expect = 9e-14
Identities = 25/153 (16%), Positives = 60/153 (39%), Gaps = 2/153 (1%)
Query: 24 QPWYGRPLIRSFQNLLRNTAAGKLFYKMVATSESVRNILCQCYNDTSQVTEELVEKILQP 83
+ + L R+F++L R + L V + + + + + VTEE ++ +Q
Sbjct: 168 EAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQ 227
Query: 84 GLETGAADVF--LEFICYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNFDSV 141
++G + + + L ++ P L+ +KD ++ + ++
Sbjct: 228 FKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPH 287
Query: 142 EDFIVLPNVGHCPQDEAPHLVNPLVESFVTRHA 174
+ + GH Q + P VN ++ ++ A
Sbjct: 288 LKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDA 320
|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Length = 268 | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283 | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271 | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291 | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Length = 310 | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Length = 297 | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 290 | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Length = 394 | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281 | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258 | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313 | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Length = 293 | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279 | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 271 | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273 | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Length = 275 | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Length = 298 | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256 | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Length = 264 | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Length = 208 | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Length = 274 | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 189 | |||
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 99.76 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 99.74 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.73 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.7 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 99.7 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 99.69 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 99.67 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 99.67 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 99.66 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 99.66 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 99.66 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 99.66 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 99.64 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 99.64 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 99.62 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 99.6 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 99.59 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 99.51 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 99.51 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 99.44 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 99.33 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 99.33 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 99.26 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 99.23 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 99.23 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 99.13 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 99.13 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 99.12 | |
| d2pl5a1 | 362 | Homoserine O-acetyltransferase {Leptospira interro | 98.97 | |
| d1qlwa_ | 318 | A novel bacterial esterase {Alcaligenes sp. [TaxId | 98.94 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 98.93 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 98.73 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 98.71 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 98.69 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 98.61 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 98.58 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 98.47 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 98.43 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 98.43 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 98.35 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 98.27 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 98.26 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 98.17 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 98.17 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 98.05 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 98.05 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 97.88 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 97.85 | |
| d1qfma2 | 280 | Prolyl oligopeptidase, C-terminal domain {Pig (Sus | 97.8 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 97.79 | |
| g1wht.1 | 409 | Serine carboxypeptidase II {Wheat (Triticum vulgar | 97.75 | |
| d1ivya_ | 452 | Human 'protective protein', HPP {Human (Homo sapie | 97.55 | |
| d1ac5a_ | 483 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 97.51 | |
| g1gxs.1 | 425 | Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T | 97.49 | |
| d1wpxa1 | 421 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 97.44 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 97.42 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 97.34 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 97.31 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 97.25 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 97.05 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 96.94 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 96.73 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 96.4 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 96.15 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 96.13 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 95.87 | |
| d1lnsa3 | 405 | X-Prolyl dipeptidyl aminopeptidase PepX, middle do | 95.1 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 94.89 | |
| d2d81a1 | 318 | Polyhydroxybutyrate depolymerase {Penicillium funi | 94.83 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 92.71 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 85.88 |
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Biotin biosynthesis protein BioH domain: Biotin biosynthesis protein BioH species: Escherichia coli [TaxId: 562]
Probab=99.76 E-value=1.6e-18 Score=109.98 Aligned_cols=84 Identities=17% Similarity=0.127 Sum_probs=70.0
Q ss_pred HHHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCHHHHHHCCCCCCCCEEECCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf 99999997509999232178989985898259999877156665204688843788189999999989455999999999
Q 029700 91 DVFLEFICYSGGPLPEELLPQVKCPVLIAWGDKDPWEPIELGRAYGNFDSVEDFIVLPNVGHCPQDEAPHLVNPLVESFV 170 (189)
Q Consensus 91 ~~~~~~~~~~~~~~~~~~l~~i~~P~lii~G~~D~~~~~~~~~~~~~~~~~~~~~~~~~~gH~~~~e~p~~~~~~i~~fl 170 (189)
..+..........+....++++++|+++|+|++|.+++++..+.+.+.+|++++++++++||++++|+|++|++.|.+||
T Consensus 172 ~~~~~~~~~~~~~~~~~~l~~i~~P~lii~G~~D~~~p~~~~~~l~~~~~~~~~~~i~~~gH~~~~e~p~~~~~~l~~fl 251 (256)
T d1m33a_ 172 DVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALK 251 (256)
T ss_dssp HHHHHHHHHHHHCCCTTGGGGCCSCEEEEEETTCSSSCGGGCC-CTTTCTTCEEEEETTCCSCHHHHSHHHHHHHHHHHH
T ss_pred HHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCHHHHCHHHHHHHHHHHH
T ss_conf 78876655411342677887545882214445677779999999998789988999899998038979999999999999
Q ss_pred HHCC
Q ss_conf 7416
Q 029700 171 TRHA 174 (189)
Q Consensus 171 ~~~~ 174 (189)
++..
T Consensus 252 ~~ig 255 (256)
T d1m33a_ 252 QRVG 255 (256)
T ss_dssp TTSC
T ss_pred HHCC
T ss_conf 9768
|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|