Citrus Sinensis ID: 029711

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MEGLVRSQISPIGAHYKQQHSVFIPKFSLKLRTNLCRARVGMMKHSKSFNSVAASVQPLEASALGRSENTLPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISGGFRHMINVCC
cccccccccccccccccccccccccccHHHHHHHHccccEEEEccccccccccccccHHHHHHccccccccccHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHcccEEEEEcccccHHHHHcc
cccHEccccccEccccEEccccccccccccHcccccEEEEEEccccccccccccccHHHHHHHHHHHccccHHHHcHHHHccccEEEEcHHHHHEcccHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHcccEEEEEEccHHHHHHHcc
meglvrsqispigahykqqhsvfipKFSLKLRTNLCRArvgmmkhsksfnsvaasvqpleasalgrsentlpskEVLQLWRTADavcfdvdstvcvDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFlekrpprlspgIDELVKKLKANNKNVYLISGGFRHMINVCC
meglvrsqispigahykqqhsvfiPKFSLKLRTNLCRARVGMMKHSKSFNSVAASVQPLEasalgrsentlpSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDflekrpprlspGIDELVKKLKANNKNvylisggfrHMINVCC
MEGLVRSQISPIGAHYKQQHSVFIPKFSLKLRTNLCRARVGMMKHSKSFNSVAASVQPLEASALGRSENTLPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRLSPGIDElvkklkannknvYLISGGFRHMINVCC
***********IGAHYKQQHSVFIPKFSLKLRTNLCRARVGMM*******************************EVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSL*****************IDELVKKLKANNKNVYLISGGFRHMINVC*
********IS*****************************VGMMK*S***********PLEASALGRSENTLPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISGGFRHMINVCC
MEGLVRSQISPIGAHYKQQHSVFIPKFSLKLRTNLCRARVGMMKHSKSFNSVAASVQPLEASALGRSENTLPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISGGFRHMINVCC
****VRSQISPIGAHYKQQHSVFIPKFSLKLRTNLCRARVGMMKHSKSFNSVAASVQPLEASALGRSENTLPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISGGFRHMINVCC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGLVRSQISPIGAHYKQQHSVFIPKFSLKLRTNLCRARVGMMKHSKSFNSVAASVQPLEASALGRSENTLPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISGGFRHMINVCC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
O82796 295 Phosphoserine phosphatase yes no 0.984 0.630 0.682 6e-69
Q99LS3 225 Phosphoserine phosphatase yes no 0.587 0.493 0.585 8e-32
Q5M819 225 Phosphoserine phosphatase yes no 0.587 0.493 0.585 8e-32
Q5RB83 225 Phosphoserine phosphatase yes no 0.587 0.493 0.576 2e-31
P78330 225 Phosphoserine phosphatase yes no 0.587 0.493 0.576 2e-31
Q2KHU0 225 Phosphoserine phosphatase yes no 0.587 0.493 0.585 2e-31
Q9VSY6 270 Phosphoserine phosphatase yes no 0.571 0.4 0.509 2e-26
O28142 344 Phosphoserine phosphatase yes no 0.529 0.290 0.396 2e-11
P0AGB2 322 Phosphoserine phosphatase yes no 0.529 0.310 0.376 9e-10
P0AGB0 322 Phosphoserine phosphatase N/A no 0.529 0.310 0.376 9e-10
>sp|O82796|SERB_ARATH Phosphoserine phosphatase, chloroplastic OS=Arabidopsis thaliana GN=PSP PE=1 SV=2 Back     alignment and function desciption
 Score =  259 bits (662), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 147/186 (79%)

Query: 1   MEGLVRSQISPIGAHYKQQHSVFIPKFSLKLRTNLCRARVGMMKHSKSFNSVAASVQPLE 60
           ME L  S++ P+    ++  S+F     L+LR   CR  V +M H K    V ASVQP E
Sbjct: 1   MEALTTSRVVPVQVPCRKLSSLFANFSCLELRRYPCRGLVSIMNHPKLLRPVTASVQPHE 60

Query: 61  ASALGRSENTLPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARA 120
            S LG   N +PSKE+L LWR+ +AVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARA
Sbjct: 61  LSTLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARA 120

Query: 121 MGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISGG 180
           MGGSVPFEEALAARLSLFKPSLS+V+++L+KRPPRLSPGI+ELVKKL+ANN +VYLISGG
Sbjct: 121 MGGSVPFEEALAARLSLFKPSLSKVEEYLDKRPPRLSPGIEELVKKLRANNIDVYLISGG 180

Query: 181 FRHMIN 186
           FR MIN
Sbjct: 181 FRQMIN 186
Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates. May be required preferentially for serine biosynthesis in non-photosynthetic tissues.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 3
>sp|Q99LS3|SERB_MOUSE Phosphoserine phosphatase OS=Mus musculus GN=Psph PE=1 SV=1 Back     alignment and function description
>sp|Q5M819|SERB_RAT Phosphoserine phosphatase OS=Rattus norvegicus GN=Psph PE=2 SV=1 Back     alignment and function description
>sp|Q5RB83|SERB_PONAB Phosphoserine phosphatase OS=Pongo abelii GN=PSPH PE=2 SV=1 Back     alignment and function description
>sp|P78330|SERB_HUMAN Phosphoserine phosphatase OS=Homo sapiens GN=PSPH PE=1 SV=2 Back     alignment and function description
>sp|Q2KHU0|SERB_BOVIN Phosphoserine phosphatase OS=Bos taurus GN=PSPH PE=2 SV=1 Back     alignment and function description
>sp|Q9VSY6|SERB_DROME Phosphoserine phosphatase OS=Drosophila melanogaster GN=aay PE=2 SV=1 Back     alignment and function description
>sp|O28142|SERB_ARCFU Phosphoserine phosphatase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2138 PE=3 SV=1 Back     alignment and function description
>sp|P0AGB2|SERB_SHIFL Phosphoserine phosphatase OS=Shigella flexneri GN=serB PE=3 SV=1 Back     alignment and function description
>sp|P0AGB0|SERB_ECOLI Phosphoserine phosphatase OS=Escherichia coli (strain K12) GN=serB PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
225457217 294 PREDICTED: phosphoserine phosphatase, ch 0.973 0.625 0.775 2e-76
224121470 295 predicted protein [Populus trichocarpa] 0.984 0.630 0.752 3e-76
255547199 295 phosphoserine phosphatase, putative [Ric 0.984 0.630 0.715 2e-72
449440850 295 PREDICTED: phosphoserine phosphatase, ch 0.984 0.630 0.682 5e-68
3759177 295 3-phosphoserine phosphatase [Arabidopsis 0.984 0.630 0.682 3e-67
42571535 295 phosphoserine phosphatase [Arabidopsis t 0.984 0.630 0.682 3e-67
297850248 295 3-phosphoserine phosphatase [Arabidopsis 0.984 0.630 0.679 7e-67
255644947208 unknown [Glycine max] 0.973 0.884 0.703 1e-65
356508496 294 PREDICTED: phosphoserine phosphatase, ch 0.968 0.622 0.696 8e-65
336441831 296 phosphoserine phosphatase [Brassica junc 0.984 0.628 0.647 6e-62
>gi|225457217|ref|XP_002284065.1| PREDICTED: phosphoserine phosphatase, chloroplastic [Vitis vinifera] gi|297733874|emb|CBI15121.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 145/187 (77%), Positives = 157/187 (83%), Gaps = 3/187 (1%)

Query: 1   MEGLVRSQISPIGAHYKQQHSVFIPKF-SLKLRTNLCRARVGMMKHSKSFNSVAASVQPL 59
           MEGL+R + +PI  H  + HS  +P F +L+L     R   GMMKH KSFNSV ASVQPL
Sbjct: 1   MEGLMRVRTNPIHLHCGRHHSPSLPAFPTLQLHKKFYRNSFGMMKHPKSFNSVVASVQPL 60

Query: 60  EASALGRSENTLPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTAR 119
           EAS   R +NTLPSKE+L+LW+ ADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTAR
Sbjct: 61  EAST--RFDNTLPSKEILELWQDADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTAR 118

Query: 120 AMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISG 179
           AMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPR+SPGID LVKKLKA N NVYLISG
Sbjct: 119 AMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRISPGIDVLVKKLKARNTNVYLISG 178

Query: 180 GFRHMIN 186
           GFR MIN
Sbjct: 179 GFRQMIN 185

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224121470|ref|XP_002318590.1| predicted protein [Populus trichocarpa] gi|118484409|gb|ABK94081.1| unknown [Populus trichocarpa] gi|222859263|gb|EEE96810.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255547199|ref|XP_002514657.1| phosphoserine phosphatase, putative [Ricinus communis] gi|223546261|gb|EEF47763.1| phosphoserine phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449440850|ref|XP_004138197.1| PREDICTED: phosphoserine phosphatase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|3759177|dbj|BAA33806.1| 3-phosphoserine phosphatase [Arabidopsis thaliana] gi|3759179|dbj|BAA33807.1| 3-phosphoserin phosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42571535|ref|NP_973858.1| phosphoserine phosphatase [Arabidopsis thaliana] gi|62900892|sp|O82796.2|SERB_ARATH RecName: Full=Phosphoserine phosphatase, chloroplastic; Short=PSP; Short=PSPase; AltName: Full=O-phosphoserine phosphohydrolase; Flags: Precursor gi|9795592|gb|AAF98410.1|AC026238_2 3-phosphoserine phosphatase [Arabidopsis thaliana] gi|17529132|gb|AAL38792.1| putative 3-phosphoserine phosphatase [Arabidopsis thaliana] gi|20465705|gb|AAM20321.1| putative 3-phosphoserine phosphatase [Arabidopsis thaliana] gi|21592986|gb|AAM64935.1| 3-phosphoserine phosphatase [Arabidopsis thaliana] gi|332191617|gb|AEE29738.1| phosphoserine phosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297850248|ref|XP_002893005.1| 3-phosphoserine phosphatase [Arabidopsis lyrata subsp. lyrata] gi|297338847|gb|EFH69264.1| 3-phosphoserine phosphatase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255644947|gb|ACU22973.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356508496|ref|XP_003522992.1| PREDICTED: phosphoserine phosphatase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|336441831|gb|ADM15724.2| phosphoserine phosphatase [Brassica juncea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2027433 295 PSP "AT1G18640" [Arabidopsis t 0.984 0.630 0.634 2.2e-57
UNIPROTKB|E1C9F4 226 PSPH "Uncharacterized protein" 0.587 0.491 0.540 2.8e-27
WB|WBGene00013379 279 Y62E10A.13 [Caenorhabditis ele 0.677 0.458 0.5 5.7e-27
MGI|MGI:97788 225 Psph "phosphoserine phosphatas 0.587 0.493 0.540 1.9e-26
RGD|1308764 225 Psph "phosphoserine phosphatas 0.587 0.493 0.540 1.9e-26
UNIPROTKB|F1RIU1 225 PSPH "Uncharacterized protein" 0.587 0.493 0.540 3.2e-26
UNIPROTKB|E2RPN5 231 PSPH "Uncharacterized protein" 0.587 0.480 0.540 4e-26
UNIPROTKB|Q2KHU0 225 PSPH "Phosphoserine phosphatas 0.587 0.493 0.540 5.2e-26
UNIPROTKB|C9JBI3187 PSPH "Phosphoserine phosphatas 0.587 0.593 0.531 8.4e-26
UNIPROTKB|P78330 225 PSPH "Phosphoserine phosphatas 0.587 0.493 0.531 8.4e-26
TAIR|locus:2027433 PSP "AT1G18640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 590 (212.7 bits), Expect = 2.2e-57, P = 2.2e-57
 Identities = 118/186 (63%), Positives = 136/186 (73%)

Query:     1 MEGLVRSQISPIGAHYKQQHSVFIPKFSLKLRTNLCRARVGMMKHSKSFNSVAASVQPLE 60
             ME L  S++ P+    ++  S+F     L+LR   CR  V +M H K    V ASVQP E
Sbjct:     1 MEALTTSRVVPVQVPCRKLSSLFANFSCLELRRYPCRGLVSIMNHPKLLRPVTASVQPHE 60

Query:    61 ASALGRSENTLPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARA 120
              S LG   N +PSKE+L LWR+ +AVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARA
Sbjct:    61 LSTLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARA 120

Query:   121 MGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPRLSPGIDEXXXXXXXXXXXXYLISGG 180
             MGGSVPFEEALAARLSLFKPSLS+V+++L+KRPPRLSPGI+E            YLISGG
Sbjct:   121 MGGSVPFEEALAARLSLFKPSLSKVEEYLDKRPPRLSPGIEELVKKLRANNIDVYLISGG 180

Query:   181 FRHMIN 186
             FR MIN
Sbjct:   181 FRQMIN 186
GO:0000287 "magnesium ion binding" evidence=IBA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004647 "phosphoserine phosphatase activity" evidence=IEA;IDA
GO:0006564 "L-serine biosynthetic process" evidence=IEA;IBA;TAS
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016791 "phosphatase activity" evidence=IEA
UNIPROTKB|E1C9F4 PSPH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00013379 Y62E10A.13 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:97788 Psph "phosphoserine phosphatase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308764 Psph "phosphoserine phosphatase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIU1 PSPH "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPN5 PSPH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KHU0 PSPH "Phosphoserine phosphatase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9JBI3 PSPH "Phosphoserine phosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P78330 PSPH "Phosphoserine phosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O82796SERB_ARATH3, ., 1, ., 3, ., 30.68270.98410.6305yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.921
3rd Layer3.1.3.30.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016203001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (294 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00011750001
SubName- Full=Chromosome undetermined scaffold_334, whole genome shotgun sequence (Chromosome u [...] (330 aa)
•  • •• 0.969
GSVIVG00032161001
RecName- Full=Serine hydroxymethyltransferase; EC=2.1.2.1;; Interconversion of serine and glyci [...] (428 aa)
•    •• 0.950
GSVIVG00015058001
RecName- Full=Serine hydroxymethyltransferase; EC=2.1.2.1;; Interconversion of serine and glyci [...] (516 aa)
•    •• 0.939
GSVIVG00026455001
RecName- Full=Serine hydroxymethyltransferase; EC=2.1.2.1;; Interconversion of serine and glyci [...] (563 aa)
•    •• 0.922
GSVIVG00015300001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (570 aa)
•    •• 0.921
GSVIVG00022240001
SubName- Full=Chromosome chr6 scaffold_25, whole genome shotgun sequence; (401 aa)
•    •• 0.919
GSVIVG00023836001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (316 aa)
     •• 0.912
GSVIVG00000395001
SubName- Full=Chromosome chr2 scaffold_105, whole genome shotgun sequence; (333 aa)
     •• 0.906
GSVIVG00000550001
SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (476 aa)
     •• 0.900
GSVIVG00027369001
SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (458 aa)
     •• 0.900

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
PLN02954 224 PLN02954, PLN02954, phosphoserine phosphatase 1e-81
TIGR00338219 TIGR00338, serB, phosphoserine phosphatase SerB 6e-31
COG0560 212 COG0560, SerB, Phosphoserine phosphatase [Amino ac 9e-19
PRK11133 322 PRK11133, serB, phosphoserine phosphatase; Provisi 4e-16
TIGR01488177 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superf 2e-13
pfam00702187 pfam00702, Hydrolase, haloacid dehalogenase-like h 2e-07
COG4359 220 COG4359, COG4359, Uncharacterized conserved protei 8e-05
pfam13419176 pfam13419, HAD_2, Haloacid dehalogenase-like hydro 2e-04
TIGR01489188 TIGR01489, DKMTPPase-SF, 2,3-diketo-5-methylthio-1 0.002
>gnl|CDD|215514 PLN02954, PLN02954, phosphoserine phosphatase Back     alignment and domain information 
 Score =  241 bits (616), Expect = 1e-81
 Identities = 99/115 (86%), Positives = 109/115 (94%)

Query: 72  PSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEAL 131
           PSK+VL+LWR+ADAVCFDVDSTVCVDEGIDELAEFCGAG+AVAEWTA+AMGGSVPFEEAL
Sbjct: 1   PSKDVLELWRSADAVCFDVDSTVCVDEGIDELAEFCGAGEAVAEWTAKAMGGSVPFEEAL 60

Query: 132 AARLSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISGGFRHMIN 186
           AARLSLFKPSLSQV++FLEKRPPRLSPGI ELVKKL+A   +VYL+SGGFR MI 
Sbjct: 61  AARLSLFKPSLSQVEEFLEKRPPRLSPGIPELVKKLRARGTDVYLVSGGFRQMIA 115

Length = 224
>gnl|CDD|232927 TIGR00338, serB, phosphoserine phosphatase SerB Back     alignment and domain information
>gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182988 PRK11133, serB, phosphoserine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233435 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|226802 COG4359, COG4359, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|213629 TIGR01489, DKMTPPase-SF, 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PLN02954 224 phosphoserine phosphatase 99.86
KOG1615 227 consensus Phosphoserine phosphatase [Amino acid tr 99.83
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.7
COG0560 212 SerB Phosphoserine phosphatase [Amino acid transpo 99.67
PRK09552 219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.64
PRK11133 322 serB phosphoserine phosphatase; Provisional 99.63
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.59
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.56
PLN02770 248 haloacid dehalogenase-like hydrolase family protei 99.52
TIGR03333 214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.51
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.45
COG0637 221 Predicted phosphatase/phosphohexomutase [General f 99.45
PLN03243 260 haloacid dehalogenase-like hydrolase; Provisional 99.44
PRK11587 218 putative phosphatase; Provisional 99.42
PRK13288214 pyrophosphatase PpaX; Provisional 99.42
PRK13226229 phosphoglycolate phosphatase; Provisional 99.4
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.39
TIGR02137 203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.38
COG0546220 Gph Predicted phosphatases [General function predi 99.38
PRK13225273 phosphoglycolate phosphatase; Provisional 99.37
PLN02575 381 haloacid dehalogenase-like hydrolase 99.37
PRK13582 205 thrH phosphoserine phosphatase; Provisional 99.37
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.35
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.35
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.35
PRK13478 267 phosphonoacetaldehyde hydrolase; Provisional 99.33
TIGR01422 253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.33
PRK13222226 phosphoglycolate phosphatase; Provisional 99.32
PRK13223 272 phosphoglycolate phosphatase; Provisional 99.3
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.29
PRK11590211 hypothetical protein; Provisional 99.29
PLN02940 382 riboflavin kinase 99.26
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.26
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.25
PRK10563 221 6-phosphogluconate phosphatase; Provisional 99.25
PRK14988224 GMP/IMP nucleotidase; Provisional 99.25
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.23
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.21
COG4359 220 Uncharacterized conserved protein [Function unknow 99.2
PF06888 234 Put_Phosphatase: Putative Phosphatase; InterPro: I 99.18
PLN02779 286 haloacid dehalogenase-like hydrolase family protei 99.18
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.17
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.15
PRK09449224 dUMP phosphatase; Provisional 99.14
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 99.12
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.11
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.11
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.1
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.09
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.09
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.08
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.07
PHA02597197 30.2 hypothetical protein; Provisional 99.01
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 98.99
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 98.94
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 98.93
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 98.89
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 98.84
PRK10748238 flavin mononucleotide phosphatase; Provisional 98.8
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 98.77
KOG3120 256 consensus Predicted haloacid dehalogenase-like hyd 98.72
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 98.68
PLN02811 220 hydrolase 98.62
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.55
PRK08238 479 hypothetical protein; Validated 98.5
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 98.37
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 98.34
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 98.18
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 98.17
TIGR01684 301 viral_ppase viral phosphatase. These proteins also 98.14
TIGR01544 277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 98.13
TIGR01533 266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 98.13
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 98.11
PHA03398 303 viral phosphatase superfamily protein; Provisional 98.04
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 98.02
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 97.86
PLN02645 311 phosphoglycolate phosphatase 97.83
PRK08942 181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 97.83
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 97.75
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 97.61
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 97.56
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 97.4
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 97.23
TIGR01675229 plant-AP plant acid phosphatase. This model explic 97.23
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 97.18
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 97.15
PLN02177 497 glycerol-3-phosphate acyltransferase 97.1
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.09
PHA02530300 pseT polynucleotide kinase; Provisional 96.97
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 96.94
PLN02499 498 glycerol-3-phosphate acyltransferase 96.79
PLN02887 580 hydrolase family protein 96.78
PRK10187 266 trehalose-6-phosphate phosphatase; Provisional 96.34
TIGR00213 176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 96.31
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 96.31
PRK06769 173 hypothetical protein; Validated 96.05
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 95.96
KOG3109 244 consensus Haloacid dehalogenase-like hydrolase [Ge 95.93
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 95.77
PRK01158 230 phosphoglycolate phosphatase; Provisional 95.51
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 95.5
PTZ00174 247 phosphomannomutase; Provisional 95.47
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 95.41
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 95.38
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 95.28
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 95.21
TIGR02244 343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 95.14
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 95.12
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 95.1
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 95.06
PRK10976 266 putative hydrolase; Provisional 95.04
TIGR02245 195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 94.91
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 94.89
COG0561 264 Cof Predicted hydrolases of the HAD superfamily [G 94.87
COG4229229 Predicted enolase-phosphatase [Energy production a 94.84
PLN02423 245 phosphomannomutase 94.82
TIGR01487 215 SPP-like sucrose-phosphate phosphatase-like hydrol 94.73
PRK10513 270 sugar phosphate phosphatase; Provisional 94.72
PRK03669 271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 94.39
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 94.35
PLN02205 854 alpha,alpha-trehalose-phosphate synthase [UDP-form 94.31
PRK00192 273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 94.08
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 94.05
PLN02580 384 trehalose-phosphatase 94.04
COG2503 274 Predicted secreted acid phosphatase [General funct 94.04
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 94.0
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 93.87
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 93.85
PF00702 215 Hydrolase: haloacid dehalogenase-like hydrolase; I 93.53
PLN02151 354 trehalose-phosphatase 93.53
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 93.2
TIGR01482 225 SPP-subfamily Sucrose-phosphate phosphatase subfam 92.95
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 92.78
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 92.72
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 92.65
TIGR01525 556 ATPase-IB_hvy heavy metal translocating P-type ATP 92.62
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 92.26
TIGR01511 562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 92.2
PF08282 254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 92.04
PF11019 252 DUF2608: Protein of unknown function (DUF2608); In 91.95
TIGR01512 536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 91.77
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 91.69
PRK10444 248 UMP phosphatase; Provisional 91.54
TIGR00099 256 Cof-subfamily Cof subfamily of IIB subfamily of ha 91.53
TIGR02463 221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 91.24
TIGR01457 249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 91.21
TIGR02461 225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 91.0
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 90.85
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 90.14
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 90.12
COG0647 269 NagD Predicted sugar phosphatases of the HAD super 90.09
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 89.89
TIGR01458 257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 89.75
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 89.71
TIGR01486 256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 89.59
COG5083580 SMP2 Uncharacterized protein involved in plasmid m 88.47
TIGR02471 236 sucr_syn_bact_C sucrose phosphate synthase, sucros 88.0
TIGR01460 236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 87.93
TIGR00685 244 T6PP trehalose-phosphatase. At least 18 distinct s 87.78
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 87.0
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 86.74
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 86.4
PF05822 246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 86.38
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 85.49
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 85.24
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 84.61
PRK06769173 hypothetical protein; Validated 83.65
COG4030 315 Uncharacterized protein conserved in archaea [Func 83.57
PLN03017 366 trehalose-phosphatase 83.24
PRK11033 741 zntA zinc/cadmium/mercury/lead-transporting ATPase 82.78
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 81.52
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 81.26
PRK10671 834 copA copper exporting ATPase; Provisional 81.23
KOG2134 422 consensus Polynucleotide kinase 3' phosphatase [Re 81.18
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 80.94
TIGR01485 249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 80.63
COG5663194 Uncharacterized conserved protein [Function unknow 80.42
TIGR01497 675 kdpB K+-transporting ATPase, B subunit. One sequen 80.02
>PLN02954 phosphoserine phosphatase Back     alignment and domain information 
Probab=99.86  E-value=3.9e-21  Score=157.39  Aligned_cols=117  Identities=85%  Similarity=1.368  Sum_probs=103.7

Q ss_pred             ChHHHHhhhcCCceEEEECCCcccccchHHHHHHHcCCCccHHHHHHHHhCCCCCHHHHHHHHHhccCCCHHHHHHHHHh
Q 029711           72 PSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFLEK  151 (189)
Q Consensus        72 ~~~~~~~~~~~~kavIFDmDGTLiDse~~~~la~~~G~~~~~~~~~~~~~gG~~~~~e~l~~~~~~~~~~~eel~~~~~~  151 (189)
                      |||+++++|+++|+++|||||||+|++++..+++.+|......+++.++++|.+++.+.+..++..+....+.+.++++.
T Consensus         1 ~~~~~~~~~~~~k~viFDfDGTL~~~~~~~~~~~~~g~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (224)
T PLN02954          1 PSKDVLELWRSADAVCFDVDSTVCVDEGIDELAEFCGAGEAVAEWTAKAMGGSVPFEEALAARLSLFKPSLSQVEEFLEK   80 (224)
T ss_pred             ChHHHHHHHccCCEEEEeCCCcccchHHHHHHHHHcCChHHHHHHHHHHHCCCCCHHHHHHHHHHHcCCCHHHHHHHHHH
Confidence            79999999999999999999999999999999999998766678888899999999998888877765566677777776


Q ss_pred             CCCCCCccHHHHHHHHHHCCCeEEEEcCCchhhhhhc
Q 029711          152 RPPRLSPGIDELVKKLKANNKNVYLISGGFRHMINVC  188 (189)
Q Consensus       152 ~~~~l~pG~~elL~~Lk~~Gi~laIVSs~~~~~i~~i  188 (189)
                      ....++||+.++|++|+++|++++|+||+.+..++++
T Consensus        81 ~~~~l~pg~~e~l~~l~~~g~~~~IvS~~~~~~i~~~  117 (224)
T PLN02954         81 RPPRLSPGIPELVKKLRARGTDVYLVSGGFRQMIAPV  117 (224)
T ss_pred             ccCCCCccHHHHHHHHHHCCCEEEEECCCcHHHHHHH
Confidence            5567999999999999999999999999999988765

>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1nnl_A 225 Crystal Structure Of Human Phosphoserine Phosphatas 2e-28
1l8l_A 225 Molecular Basis For The Local Confomational Rearran 2e-28
3n28_A 335 Crystal Structure Of Probable Phosphoserine Phospha 3e-08
1f5s_A 211 Crystal Structure Of Phosphoserine Phosphatase From 6e-08
1l7m_A 211 High Resolution Liganded Structure Of Phosphoserine 5e-07
1j97_A 211 Phospho-Aspartyl Intermediate Analogue Of Phosphose 6e-07
1l7o_A 211 Crystal Structure Of Phosphoserine Phosphatase In A 2e-06
4eze_A 317 Crystal Structure Of Had Family Hydrolase T0658 Fro 1e-05
3p96_A 415 Crystal Structure Of Phosphoserine Phosphatase Serb 6e-04
>pdb|1NNL|A Chain A, Crystal Structure Of Human Phosphoserine Phosphatase Length = 225 Back     alignment and structure 
Iteration: 1

 Score =  122 bits (305), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%)
Query: 75  EVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAAR 134
           E+ +L+ +ADAVCFDVDSTV  +EGIDELA+ CG   AV+E T RAMGG+VPF+ AL  R
Sbjct: 6   ELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTER 65
Query: 135 LSLFKPSLSQVQDFLEKRPPRLSPGIDEXXXXXXXXXXXXYLISGGFRHMI 185
           L+L +PS  QVQ  + ++PP L+PGI E            +LISGGFR ++
Sbjct: 66  LALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIV 116
>pdb|1L8L|A Chain A, Molecular Basis For The Local Confomational Rearrangement Of Human Phosphoserine Phosphatase Length = 225 Back     alignment and structure
>pdb|3N28|A Chain A, Crystal Structure Of Probable Phosphoserine Phosphatase From Vibrio Cholerae, Unliganded Form Length = 335 Back     alignment and structure
>pdb|1F5S|A Chain A, Crystal Structure Of Phosphoserine Phosphatase From Methanococcus Jannaschii Length = 211 Back     alignment and structure
>pdb|1L7M|A Chain A, High Resolution Liganded Structure Of Phosphoserine Phosphatase (Pi Complex) Length = 211 Back     alignment and structure
>pdb|1J97|A Chain A, Phospho-Aspartyl Intermediate Analogue Of Phosphoserine Phosphatase Length = 211 Back     alignment and structure
>pdb|1L7O|A Chain A, Crystal Structure Of Phosphoserine Phosphatase In Apo Form Length = 211 Back     alignment and structure
>pdb|4EZE|A Chain A, Crystal Structure Of Had Family Hydrolase T0658 From Salmonella Enterica Subsp. Enterica Serovar Typhi (Target Efi-501419) Length = 317 Back     alignment and structure
>pdb|3P96|A Chain A, Crystal Structure Of Phosphoserine Phosphatase Serb From Mycobacterium Avium, Native Form Length = 415 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1nnl_A 225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 3e-55
3kd3_A 219 Phosphoserine phosphohydrolase-like protein; csgid 1e-44
2fea_A 236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 8e-34
1l7m_A 211 Phosphoserine phosphatase; rossmann fold, four-hel 2e-31
4eze_A 317 Haloacid dehalogenase-like hydrolase; magnesium bi 5e-30
3n28_A 335 Phosphoserine phosphatase; HAD family hydrolase, s 4e-29
3m1y_A 217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 1e-28
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 2e-20
1rku_A 206 Homoserine kinase; phosphoserine phosphatase, phos 2e-19
3fvv_A 232 Uncharacterized protein; unknown function, structu 9e-12
2g09_A 297 Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMP 1e-05
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Length = 225 Back     alignment and structure
 Score =  173 bits (441), Expect = 3e-55
 Identities = 64/116 (55%), Positives = 85/116 (73%)

Query: 71  LPSKEVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEA 130
           +   E+ +L+ +ADAVCFDVDSTV  +EGIDELA+ CG   AV+E T RAMGG+VPF+ A
Sbjct: 2   ISHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAA 61

Query: 131 LAARLSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISGGFRHMIN 186
           L  RL+L +PS  QVQ  + ++PP L+PGI ELV +L+  N  V+LISGGFR ++ 
Sbjct: 62  LTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVE 117
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Length = 219 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Length = 211 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317 Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Length = 415 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Length = 206 Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Length = 232 Back     alignment and structure
>2g09_A Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMPH-1, pyrim nucleotidase 1, P5N-1, NT5C3 protein, AAH38029, BC038029, M LEAD poisoning; HET: PIN; 2.10A {Mus musculus} PDB: 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Length = 297 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
1nnl_A 225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.71
4eze_A 317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.59
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 99.59
2fea_A 236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.55
3m1y_A 217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.54
1l7m_A 211 Phosphoserine phosphatase; rossmann fold, four-hel 99.54
3fvv_A 232 Uncharacterized protein; unknown function, structu 99.51
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.49
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.45
3kd3_A 219 Phosphoserine phosphohydrolase-like protein; csgid 99.43
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.33
3n28_A 335 Phosphoserine phosphatase; HAD family hydrolase, s 99.32
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.31
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.3
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.29
4g9b_A 243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.29
3l5k_A 250 Protein GS1, haloacid dehalogenase-like hydrolase 99.29
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.28
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.27
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.25
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.24
2p11_A 231 Hypothetical protein; putative haloacid dehalogena 99.24
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.24
2nyv_A 222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.24
3mc1_A 226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.23
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.23
4eek_A 259 Beta-phosphoglucomutase-related protein; hydrolase 99.22
3s6j_A 233 Hydrolase, haloacid dehalogenase-like family; stru 99.21
3dv9_A 247 Beta-phosphoglucomutase; structural genomics, APC6 99.2
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.18
1rku_A 206 Homoserine kinase; phosphoserine phosphatase, phos 99.18
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.17
3ed5_A 238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.17
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.16
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.16
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.15
3nas_A 233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.14
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 99.13
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.13
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.12
2hcf_A 234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.11
3m9l_A 205 Hydrolase, haloacid dehalogenase-like family; HAD 99.11
1zrn_A 232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.09
3smv_A 240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.09
2no4_A 240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.09
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 99.09
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.09
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.09
3iru_A 277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.08
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.06
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.04
2hoq_A 241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.04
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.03
3k1z_A 263 Haloacid dehalogenase-like hydrolase domain-conta 99.03
3d6j_A 225 Putative haloacid dehalogenase-like hydrolase; str 99.03
1te2_A226 Putative phosphatase; structural genomics, phospha 99.03
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.02
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.02
3nuq_A 282 Protein SSM1, putative nucleotide phosphatase; sup 99.01
2gfh_A 260 Haloacid dehalogenase-like hydrolase domain conta; 99.01
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.99
1qq5_A 253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.98
3umg_A 254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 98.98
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 98.97
2qlt_A 275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 98.95
2fdr_A 229 Conserved hypothetical protein; SAD, structural ge 98.92
3u26_A 234 PF00702 domain protein; structural genomics, PSI-b 98.92
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.9
1swv_A 267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.89
3umc_A 254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.89
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 98.89
2pke_A 251 Haloacid delahogenase-like family hydrolase; NP_63 98.88
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.83
3skx_A 280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 98.82
2oda_A 196 Hypothetical protein pspto_2114; haloacid dehaloge 98.8
2i33_A 258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 98.77
4as2_A 327 Phosphorylcholine phosphatase; hydrolase, HAD supe 98.77
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 98.76
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 98.71
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 98.68
1y8a_A 332 Hypothetical protein AF1437; structural genomics, 98.64
3mn1_A 189 Probable YRBI family phosphatase; structural genom 98.52
3ij5_A 211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.51
3mmz_A 176 Putative HAD family hydrolase; structural genomics 98.44
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.41
4gxt_A 385 A conserved functionally unknown protein; structur 98.41
2gmw_A 211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.37
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.35
3pct_A 260 Class C acid phosphatase; hydrolase, outer membran 98.32
3ocu_A 262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 98.31
3ib6_A 189 Uncharacterized protein; structural genomics, unkn 98.29
3l8h_A 179 Putative haloacid dehalogenase-like hydrolase; HAD 98.28
3n07_A 195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.28
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 98.25
4fe3_A 297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 98.21
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 97.49
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.14
1k1e_A 180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 98.13
2c4n_A 250 Protein NAGD; nucleotide phosphatase, HAD superfam 98.06
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 98.06
1yv9_A 264 Hydrolase, haloacid dehalogenase family; hypotheti 98.01
3n1u_A 191 Hydrolase, HAD superfamily, subfamily III A; struc 98.0
3dao_A 283 Putative phosphatse; structural genomics, joint ce 97.94
2ho4_A 259 Haloacid dehalogenase-like hydrolase domain contai 97.93
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 97.93
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 97.92
2hx1_A 284 Predicted sugar phosphatases of the HAD superfamil 97.92
3r4c_A 268 Hydrolase, haloacid dehalogenase-like hydrolase; h 97.91
2r8e_A 188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 97.89
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 97.82
3pgv_A 285 Haloacid dehalogenase-like hydrolase; structural g 97.78
3gyg_A 289 NTD biosynthesis operon putative hydrolase NTDB; P 97.77
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 97.76
2o2x_A 218 Hypothetical protein; structural genomics, joint c 97.72
2b30_A 301 Pvivax hypothetical protein; SGPP, structural geno 97.5
1vjr_A 271 4-nitrophenylphosphatase; TM1742, structural genom 97.44
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 97.42
1xvi_A 275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 97.39
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 97.37
1zjj_A 263 Hypothetical protein PH1952; alpha/beta hydrolase 97.22
2x4d_A 271 HLHPP, phospholysine phosphohistidine inorganic py 97.02
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 96.98
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 96.95
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 96.89
3qle_A 204 TIM50P; chaperone, mitochondrion, preprotein trans 96.84
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 96.84
3qgm_A 268 P-nitrophenyl phosphatase (PHO2); structural genom 96.62
1wr8_A 231 Phosphoglycolate phosphatase; alpha / beta core do 96.52
2pq0_A 258 Hypothetical conserved protein GK1056; hyopthetica 96.5
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 96.44
3epr_A 264 Hydrolase, haloacid dehalogenase-like family; stru 96.4
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 96.27
3pdw_A 266 Uncharacterized hydrolase YUTF; structural genomic 96.22
2rbk_A 261 Putative uncharacterized protein; HAD-like phospha 95.91
1rlm_A 271 Phosphatase; HAD family, rossman fold, hydrolase; 95.91
1nf2_A 268 Phosphatase; structural proteomics, HAD NEW fold, 95.9
1qyi_A 384 ZR25, hypothetical protein; structural genomics, P 95.77
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.72
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 95.68
2amy_A 246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 95.6
3f9r_A 246 Phosphomannomutase; trypanosome glycobiology struc 95.59
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 95.54
3zx4_A 259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 95.24
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 95.01
2fue_A 262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 95.01
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 94.89
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 94.87
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 94.76
2zos_A 249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 94.1
1l6r_A 227 Hypothetical protein TA0175; structural genomics, 94.0
1u02_A 239 Trehalose-6-phosphate phosphatase related protein; 93.75
1s2o_A 244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 93.21
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 90.31
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 89.56
1qyi_A 384 ZR25, hypothetical protein; structural genomics, P 87.36
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 85.88
3j08_A 645 COPA, copper-exporting P-type ATPase A; copper tra 84.15
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 80.63
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
Probab=99.71  E-value=3e-17  Score=130.82  Aligned_cols=113  Identities=56%  Similarity=0.950  Sum_probs=80.5

Q ss_pred             HHhhhcCCceEEEECCCcccccchHHHHHHHcCCCccHHHHHHHHhCCCCCHHHHHHHHHhccCCCHHHHHHHHHhCCCC
Q 029711           76 VLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPPR  155 (189)
Q Consensus        76 ~~~~~~~~kavIFDmDGTLiDse~~~~la~~~G~~~~~~~~~~~~~gG~~~~~e~l~~~~~~~~~~~eel~~~~~~~~~~  155 (189)
                      ..+++.++++|+|||||||+|++.+..+++.+|.+....+....+++|..++.+.+...+..+....+.+.+++.....+
T Consensus         7 m~~~~~~~k~viFD~DGTLvd~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   86 (225)
T 1nnl_A            7 LRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPH   86 (225)
T ss_dssp             HHHHHHHCSEEEEETBTTTBSSCHHHHHHHHTTCTTTC------------CHHHHHHHHHHHHCCCHHHHHHHHHHSCCC
T ss_pred             HHHHHhhCCEEEEeCcccccccccHHHHHHHhCCcHHHHHHHHHHHcCCccHHHHHHHHHHHhcCCHHHHHHHHHhccCC
Confidence            44566778999999999999999998888888876433445556666667777777655544434556667777664568


Q ss_pred             CCccHHHHHHHHHHCCCeEEEEcCCchhhhhhc
Q 029711          156 LSPGIDELVKKLKANNKNVYLISGGFRHMINVC  188 (189)
Q Consensus       156 l~pG~~elL~~Lk~~Gi~laIVSs~~~~~i~~i  188 (189)
                      ++||+.++|+.|+++|++++|+||++...++.+
T Consensus        87 ~~~g~~~~l~~L~~~g~~~~i~T~~~~~~~~~~  119 (225)
T 1nnl_A           87 LTPGIRELVSRLQERNVQVFLISGGFRSIVEHV  119 (225)
T ss_dssp             BCTTHHHHHHHHHHTTCEEEEEEEEEHHHHHHH
T ss_pred             CCccHHHHHHHHHHCCCcEEEEeCChHHHHHHH
Confidence            999999999999999999999999998776643
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1nnla_ 217 c.108.1.4 (A:) Phosphoserine phosphatase {Human (H 1e-29
d2feaa1 226 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio 1e-12
d1j97a_ 210 c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon 6e-11
d1rkua_ 206 c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomona 2e-10
d2bdua1 291 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III 1e-06
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Phosphoserine phosphatase
domain: Phosphoserine phosphatase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  106 bits (265), Expect = 1e-29
 Identities = 64/115 (55%), Positives = 84/115 (73%)

Query: 75  EVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAAR 134
           E+ +L+ +ADAVCFDVDSTV  +EGIDELA+ CG   AV+E T RAMGG+VPF+ AL  R
Sbjct: 2   ELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTER 61

Query: 135 LSLFKPSLSQVQDFLEKRPPRLSPGIDELVKKLKANNKNVYLISGGFRHMINVCC 189
           L+L +PS  QVQ  + ++PP L+PGI ELV +L+  N  V+LISGGFR ++    
Sbjct: 62  LALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA 116
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 210 Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Length = 206 Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Length = 291 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1nnla_ 217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.81
d2feaa1 226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.57
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.46
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.42
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.41
d1j97a_ 210 Phosphoserine phosphatase {Archaeon Methanococcus 99.4
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.38
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.33
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.27
d1swva_ 257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.25
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.17
d2fdra1 222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.15
d2hcfa1 228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.01
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 98.92
d1rkua_ 206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 98.9
d2gfha1 247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 98.8
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 98.77
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 98.77
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 98.77
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 98.75
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 98.73
d2bdua1 291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 98.69
d1qq5a_ 245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 98.64
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.54
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 98.42
d2gmwa1 182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 98.0
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 97.94
d2o2xa1 209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 97.72
d2g80a1 225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 97.65
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 97.38
d2b30a1 283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 97.32
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.13
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 96.95
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 96.71
d1wr8a_ 230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 96.67
d2c4na1 250 NagD {Escherichia coli [TaxId: 562]} 96.54
d2amya1 243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 96.53
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 96.45
d1l6ra_ 225 Phosphoglycolate phosphatase, PGPase {Archaeon The 96.41
d1yv9a1 253 Putative hydrolase EF1188 {Enterococcus faecalis [ 96.17
d1nf2a_ 267 Hypothetical protein TM0651 {Thermotoga maritima [ 96.0
d1wvia_ 253 Putative phosphatase SMU.1415c {Streptococcus muta 95.93
d1wzca1 243 Putative mannosyl-3-phosphoglycerate phosphatase M 95.72
d1rkqa_ 271 Hypothetical protein YidA {Escherichia coli [TaxId 95.61
d2fuea1 244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 95.52
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 95.41
d2rbka1 260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 95.34
d1rlma_ 269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 94.97
d1qyia_ 380 Hypothetical protein MW1667 (SA1546) {Staphylococc 94.66
d1xvia_ 232 Putative mannosyl-3-phosphoglycerate phosphatase M 94.49
d1u02a_ 229 Trehalose-6-phosphate phosphatase related protein 94.42
d1s2oa1 244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 94.2
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 93.36
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 93.35
d1qyia_ 380 Hypothetical protein MW1667 (SA1546) {Staphylococc 90.8
d1y8aa1 308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 89.98
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 87.73
d1yj5a1 195 5' polynucleotide kinase-3' phosphatase, middle do 85.38
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 83.22
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Phosphoserine phosphatase
domain: Phosphoserine phosphatase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.81  E-value=2.6e-20  Score=149.23  Aligned_cols=114  Identities=56%  Similarity=0.952  Sum_probs=88.7

Q ss_pred             HHHhhhcCCceEEEECCCcccccchHHHHHHHcCCCccHHHHHHHHhCCCCCHHHHHHHHHhccCCCHHHHHHHHHhCCC
Q 029711           75 EVLQLWRTADAVCFDVDSTVCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSQVQDFLEKRPP  154 (189)
Q Consensus        75 ~~~~~~~~~kavIFDmDGTLiDse~~~~la~~~G~~~~~~~~~~~~~gG~~~~~e~l~~~~~~~~~~~eel~~~~~~~~~  154 (189)
                      |+.++.++.++|+|||||||+++++|++++..+|...+..+++.+++.|.+++.+.+..+...+++..+++.+.+.+...
T Consensus         2 ~~~~~~~~~~aV~FD~DGTLi~~e~~~~l~~~~g~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (217)
T d1nnla_           2 ELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPP   81 (217)
T ss_dssp             HHHHHHHHCSEEEEETBTTTBSSCHHHHHHHHTTCTTTC------------CHHHHHHHHHHHHCCCHHHHHHHHHHSCC
T ss_pred             chhHhhCCCCEEEEcCccccCCccHHHHHHHHcCChHHHHHHHHHHHcCCCCHHHHHHHHHHhcccchHHHHHHHHhhcc
Confidence            57889999999999999999999999999999998877777888888899999999988887777766555554444447


Q ss_pred             CCCccHHHHHHHHHHCCCeEEEEcCCchhhhhhc
Q 029711          155 RLSPGIDELVKKLKANNKNVYLISGGFRHMINVC  188 (189)
Q Consensus       155 ~l~pG~~elL~~Lk~~Gi~laIVSs~~~~~i~~i  188 (189)
                      .++||+.++|++|+++|++++|||++...+++++
T Consensus        82 ~l~pg~~~~i~~lk~~G~~~~ivS~~~~~~v~~i  115 (217)
T d1nnla_          82 HLTPGIRELVSRLQERNVQVFLISGGFRSIVEHV  115 (217)
T ss_dssp             CBCTTHHHHHHHHHHTTCEEEEEEEEEHHHHHHH
T ss_pred             ccCHHHHHHHHHHHhCCCEEEEECCCchHHHHHH
Confidence            8999999999999999999999999999998876
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure