Citrus Sinensis ID: 029750

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19

MSRVPEVKWAQRQDKVFITVQLPDAKNAKVNLEPEGVFSFSASAGAENHLYELKLELFDKVNVEESKINVGVRSIFCIVEKAEKGWWKKLLRGDGKTPHYVKVDWDKWVDEDEDNGAGDLDLGGMDFSNFGGMGGDDGMGGFEDSDDEEVSKPQQEVRKAGDTNQEEEGEDKSDAGITEGKTEAAQST

ccccccEEEEECccEEEEEEEEcccccccEEEECccEEEEEECccccccEEEEEEEccccccccccCEECcccEEEEEEEEccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccc

*SRVPEVKWAQRQDKVFITVQLPDAKNAKVNLEPEGVFSFSASAGAENHLYELKLELFDKVNVEESKINVGVRSIFCIVEKAEKGWWKKLLRGDGKTPHYVKVDWDKWVDEDEDNGAGDLDLG*****************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSRVPEVKWAQRQDKVFITVQLPDAKNAKVNLEPEGVFSFSASAGAENHLYELKLELFDKVNVEESKINVGVRSIFCIVEKAEKGWWKKLLRGDGKTPHYVKVDWDKWVDEDEDNGAGDLDLGGMDFSNFGGMGGDDGMGGFEDSDDEEVSKPQQEVRKAGDTNQEEEGEDKSDAGITEGKTEAAQST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Uncharacterized protein Os08g0359500		probable	Q6YYB0
Uncharacterized protein OsI_027940		probable	P0C8Z0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KMW, chain A
Confidence level:very confident
Coverage over the Query: 1-125,136-155
View the alignment between query and template
View the model in PyMOL