Citrus Sinensis ID: 029873

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MADSSSNQTHSKEHNYRRYHPYQQFDVPIQNLYNLPTSPEFLFHEESLNSRRSWGENLQYYTGSGYLSGAVLGAIKGSVEGLRQAEPSDSLKLRVNRVLNSGGQVGRRFGNSLGVLGLIFAGMESGLIYLRDSDDLLNTVAAGLGTGAIYRAAGGLRSAAVAGAIGGITAAAAVAGKQAVKRYVPI
cccccccccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
*****************RYHPYQQFDVPIQNLYNLPTSPEFLFHEESLNSRRSWGENLQYYTGSGYLSGAVLGAIKGSVEGL*********KLRVNRVLNSGGQVGRRFGNSLGVLGLIFAGMESGLIYLRDSDDLLNTVAAGLGTGAIYRAAGGLRSAAVAGAIGGITAAAAVAGKQAVKRYVPI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSSSNQTHSKEHNYRRYHPYQQFDVPIQNLYNLPTSPEFLFHEESLNSRRSWGENLQYYTGSGYLSGAVLGAIKGSVEGLRQAEPSDSLKLRVNRVLNSGGQVGRRFGNSLGVLGLIFAGMESGLIYLRDSDDLLNTVAAGLGTGAIYRAAGGLRSAAVAGAIGGITAAAAVAGKQAVKRYVPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import inner membrane translocase subunit TIM23-1 Essential component of the TIM17:23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Links the inner and outer membranes.probableQ9LNQ1
Mitochondrial import inner membrane translocase subunit tim23 Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.probableQ9USM7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted