Citrus Sinensis ID: 029904

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----

MAPVGPRSGDAIFANVERNAELFTLTYGATVRQLLTDLEEVEEVNKQLDQMGYNIGIRLIDEFLAKSNVTRCVDFRETAEVIAKVGFKMFLGVTATVSNWDADGTCCSIILEDNPLVDFVELPDTCQGLYYCNILSGVIRGALEMVSMKTEVTWIRDVLRGDDAYELQVKLLKQVPEEYPYKDDE

ccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccCECcccccccEEEEEECccccccccccccccccccHHHHHHHHHHHHHHHcEEEEEEEEEEEcccccccEEEEEEEcccccccccccccc

******R***AIFANVERNAELFTLTYGATVRQLLTDLEEVEEVNKQLDQMGYNIGIRLIDEFLAKSNVTRCVDFRETAEVIAKVGFKMFLGVTATVSNWDADGTCCSIILEDNPLVDFVELPDTCQGLYYCNILSGVIRGALEMVSMKTEVTWIRDVLRGDDAYELQVKLLKQVPE********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAPVGPRSGDAIFANVERNAELFTLTYGATxxxxxxxxxxxxxxxxxxxxxGYNIGIRLIDEFLAKSNVTRCVDFRETAEVIAKVGFKMFLGVTATVSNWDADGTCCSIILEDNPLVDFVELPDTCQGLYYCNILSGVIRGALEMVSMKTEVTWIRDVLRGDDAYELQVKLLKQVPEEYPYKDDE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Trafficking protein particle complex subunit 3	May play a role in vesicular transport from endoplasmic reticulum to Golgi.	probable	Q5ZI57
Trafficking protein particle complex subunit 3	May play a role in vesicular transport from endoplasmic reticulum to Golgi.	probable	Q86K94
Trafficking protein particle complex subunit 3	May play a role in vesicular transport from endoplasmic reticulum to Golgi.	probable	O43617

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CUE, chain D
Confidence level:very confident
Coverage over the Query: 3-184
View the alignment between query and template
View the model in PyMOL