Citrus Sinensis ID: 029920


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MGLLSIIRKIKKKEKEMRILMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTVTYQKYTLNIWDVGGQRTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSGASLLILANKQDINGALTPTEIAKVLNLEAMDKTRHWKIVGCSAYTGEGLLEGFDWLVQDIASRIYLLD
cccHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHccccccccccccEEEEEEEEccEEEEEEEccccccccccHHHHcccccEEEEEEEccccccHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHcccccccccccEEEEEccccccccHHHHHHHHHHHHHHcccccc
MGLLSIIRKIKKKEKEMRILMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTVTYQKYTLNIWDVGGQRTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSGASLLILANKQDINGALTPTEIAKVLNLEAMDKTRHWKIVGCSAYTGEGLLEGFDWLVQDIASRIYLL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLLSIIRKIKKKEKEMRILMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTVTYQKYTLNIWDVGGQRTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLSGASLLILANKQDINGALTPTEIAKVLNLEAMDKTRHWKIVGCSAYTGEGLLEGFDWLVQDIASRIYLLD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ADP-ribosylation factor At2g18390 GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.confidentQ9ZPX1
ADP-ribosylation factor-like protein 3 Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). Required for normal cytokinesis and cilia signaling. Required for targeting proteins to the ciliary membrane by releasing myristoylated protein from unc119 cargo adapters into the cilium.probableB5FYQ0
ADP-ribosylation factor-like protein 2 Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle.probableQ9D0J4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KSH, chain A
Confidence level:very confident
Coverage over the Query: 15-180
View the alignment between query and template
View the model in PyMOL