Citrus Sinensis ID: 029961


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MVKAYTQEHIYKHPWERVTSASWRKFADPENKRTLSHILEVDTLNHKLDPLSGKLYTTRALTVHAPGPWFVRKIIGQDICHCVESTVVDAQSKSMQLTTRNVSLKKYIEVEEKIRYEPHPDNPTGWTVCRQETSIRIKPLSALASMAEKVELRCAEKFMQNSVKGREVMERICKYLEAESRGISL
cccEEEEEEEECccHHHHHHHHHHHcccccccccccEEEEEEEEEEECcccccEEEEEEEEEEcccccHHHHHHccccEEEEEEEEEEEccccEEEEEEEEccccEEEEEEEEEEEECccccccccEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
MVKAYTQEHIYKHPWERVTSASWRKFADPENKRTLSHILEVDTLNHKLDPLSGKLYTTRALTVHAPGPWFVRKIIGQDICHCVESTVVDAQSKSMQLTTRNVSLKKYIEVEEKIRYEPHPDNPTGWTVCRQETSIRIKPLSALASMAEKVELRCAEKFMQNSVKGREVMERICKYLEA*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKAYTQEHIYKHPWERVTSASWRKFADPENKRTLSHILEVDTLNHKLDPLSGKLYTTRALTVHAPGPWFVRKIIGQDICHCVESTVVDAQSKSMQLTTRNVSLKKYIEVEEKIRYEPHPDNPTGWTVCRQETSIRIKPLSALASMAEKVELRCAEKFMQNSVKGREVMERICKYLEAESRGISL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein slowmo homolog 2 probableQ6TMK8
UPS-like protein C36.10 Required for mitochondrial morphology. May control phospholipid metabolism in the mitochondrial intermembrane space.probableO59707
Protein slowmo homolog 2 probableQ9Y3B1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KCM, chain A
Confidence level:probable
Coverage over the Query: 40-119
View the alignment between query and template
View the model in PyMOL
Template: 1TW0, chain A
Confidence level:probable
Coverage over the Query: 2-65,76-138
View the alignment between query and template
View the model in PyMOL