Citrus Sinensis ID: 029973


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MAPKQGKPRVSRNPELIRGIGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPKPKAAAPAEKPPKFYPADDVKKPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKINGVPLRRVNQSYVIGTSTKVDISGVNVDKFDDKYFAKEVERKKKKGENEFFESEKEVR
ccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccEEcccEEEEEEEccccEEEEEcccEEccccCEECcccEEEEccEEEEccccccccccHHHHHHHHHHHHHcccccccccccccc
************NPELIRGIGKFSRSKMYHKRGLWAIKAKNGGV***************KPPKFYPADD******************SITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKINGVPLRRVNQSYVIGTSTKVDISGVNVDKFDDKYFA**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPKQGKPRVSRNPELIRGIGKFSRSKMYHKRGLWAIKAKNGGVFPRHDPKPKAAAPAEKPPKFYPADDVKKPLVNKRKPKPTKLRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLVSGPFKINGVPLRRVNQSYVIGTSTKVDISGVNVDKFDDKYFxxxxxxxxxxxxxxxxxxxxxVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L6-1 probableQ9FZ76
60S ribosomal protein L6 probableP34091
60S ribosomal protein L6 probableP79071

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A18, chain E
Confidence level:very confident
Coverage over the Query: 58-180
View the alignment between query and template
View the model in PyMOL
Template: 3IZR, chain G
Confidence level:very confident
Coverage over the Query: 19-183
View the alignment between query and template
View the model in PyMOL