Citrus Sinensis ID: 030008

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----

MGLWEAFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGQPRFRSMWERYCRAVSAIVYVVDAADPDNLSISRSELHDLLNKPSLSGIPLLVLGNKIDKPGALSKQALTDEMGLKSITDREVCCFMISCKNSTNIDSVIDWLVKHSKSKS

cccHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHccccccccccccccccEEEEEEccEEEEEEEEccccccccHHHHHcccccEEEEEEEccccccHHHHHHHHHHHccccccccccEEEEEccccccccccHHHHHHHccccccccccEEEEEEECcccccHHHHHHHHHHHHcccc

MGLWEAFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGQPRFRSMWERYCRAVSAIVYVVDAADPDNLSISRSELHDLLNKPSLSGIPLLVLGNKIDKPGALSKQALTDEMGLKSITDREVCCFMISCKNSTNIDSVIDWLVKHS****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGLWEAFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGQPRFRSMWERYCRAVSAIVYVVDAADPDNLSISRSELHDLLNKPSLSGIPLLVLGNKIDKPGALSKQALTDEMGLKSITDREVCCFMISCKNSTNIDSVIDWLVKHSKSKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ADP-ribosylation factor-like protein 8	May play a role in lysosome motility (PubMed:16537643). Essential role in chromosome segregation (PubMed:15331635).	probable	Q9VHV5
ADP-ribosylation factor-like protein 8B	May play a role in lysosomes motility. Alternatively, may play a role in chromosome segregation.	probable	Q5R6E7
ADP-ribosylation factor-like protein 8A	May play a role in lysosomes motility. Alternatively, may play a role in chromosome segregation.	probable	Q5ZKQ8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZD9, chain A
Confidence level:very confident
Coverage over the Query: 16-181
View the alignment between query and template
View the model in PyMOL