Citrus Sinensis ID: 030018

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----

MSQEVRGYFEAVLNSLATNVSKAVVLCQVEKAKEDMLNQLYSSVGAQSTARIEELLQEDQNVKRRRDRYQKQSELLSKLTRQLSIHDNRAAAASNWSDGGGGAESSPRTSAASGDDWRSAFDAAANGPVSLRSYSRSASNGHSRRYSDPAENGDVRSGSNSGSRRTPNRVPPPPPPTQSGSKYF

cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

****VRGYFEAVLNSLATNVSKAVVLCQVEKAKEDMLNQLYSSVGAQSTARIEELLQEDQNVKRRRDRYQKQSELLSKLTRQLSIHDNRA**********************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSQEVRGYFEAVLNSLATNVSKAVVLCQVEKAKEDMLNQLYSSVGAQSTARxxxxxxxxxxxxxxxxxxxxxSELLSKLTRQLSIHDNRAAAASNWSDGGGGAESSPRTSAASGDDWRSAFDAAANGPVSLRSYSRSASNGHSRRYSDPAENGDVRSGSNSGSRRTPNRVPPPPPPTQSGSKYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dynamin-2B	Putative microtubule-associated force-producing protein, able to bind and hydrolyze GTP.	probable	Q9LQ55

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SZR, chain A
Confidence level:confident
Coverage over the Query: 2-71
View the alignment between query and template
View the model in PyMOL