Citrus Sinensis ID: 030035

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKVLYSSSTVEIQEVCLMPF
cEEEEEEccccHHHHHHHHHHcccEEEEEccccccccccEEEEccccHHHHHHHHHHcccHHHHHHHHHccccCEECHHHHHHHHHHHHccccccccccccccEEEEccccccccccEEEECccccccccccccccCEEEEEEcCEEEEcccccEEEEEEECccccEEEECccccccccccccc
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKVLYSSSTVEIQEV**MP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKVLYSSSTVEIQEVCLMPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyridoxal biosynthesis protein PDX2 Involved in the production of pyridoxal (vitamin B6) and indirect resistance to singlet oxygen-generating photosensitizers.probableQ8LAD0
Glutamine amidotransferase subunit PdxT Involved in the hydrolysis of glutamine to glutamate and ammonia. Channels an ammonia molecule to PdxS.probableA0LUK9
Glutamine amidotransferase subunit PdxT Involved in the hydrolysis of glutamine to glutamate and ammonia. Channels an ammonia molecule to PdxS.probableB7IEZ6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ISS, chain D
Confidence level:very confident
Coverage over the Query: 1-161
View the alignment between query and template
View the model in PyMOL