Citrus Sinensis ID: 030037

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MSSPSKRRDMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQSWSPMFDLLNIFESFLPQLLLYPNPSDPLNGDAASLMMKDRKQYDQKVKEYCERYAKKENIVNSTADEESGDEEISEEESESSDDDIAGHADP
cccccHHHHHHHHHHccccccEEEccccccEEEEEEEccccccccccEEEEEEEccccccccccEEEECccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc
**********DVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQSWSPMFDLLNIFESFLPQLLLYPNPSDPLNGDAASLMMKDRKQYDQKVKEYCERY**************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSPSKRRDMDVMKLMMSDYNVETINDGLNEFNVEFHGPKESLYEGGVWKIRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQSWSPMFDLLNIFESFLPQLLLYPNPSDPLNGDAASLMMKDRKQYDQKVKEYCERYAKKENIVNSTADEESGDEEISEEESESSDDDIAGHADP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 5 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.confidentP42749
Ubiquitin-conjugating enzyme E2-23 kDa Catalyzes the covalent attachment of ubiquitin to other proteins.probableP16577
Ubiquitin-conjugating enzyme E2 H Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Capable, in vitro, to ubiquitinate histone H2A.probableQ32LN1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z5D, chain A
Confidence level:very confident
Coverage over the Query: 4-153
View the alignment between query and template
View the model in PyMOL