Citrus Sinensis ID: 030061


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MGETLISLDRATVLPLILLLCLACYICVVPVTEAIWLQIPSSGTKCVSEEINSNVVVLADYYVIDEAHPEHPPTVSAKVTSPYGNNLHHNENVTHGQFAFTTTEAGNYMACFWLGSNPQKVADATLGLDWRIGFSAKDWESVAKKDKIEGVELHLKRLEAQVQSIHENLLFLKHRSSLFLPPF
ccccccccccccHHHHHHHHHHHHHHHHHccEEEEEEECccccccCEEEEcccccEEEEEEEEEcccccccccEEEEEEEcccccEEEEECcccCEEEEEEEccccEEEEEEEEcccccccccEEEEEEEECccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
****LISLDRATVLPLILLLCLACYICVVPVTEAIWLQIPSSGTKCVSEEINSNVVVLADYYVIDEAHPEHPPTVSAKVTSPYGNNLHHNENVTHGQFAFTTTEAGNYMACFWLGSNPQKVADATLGLDWRIGFSAKDWESVAKKDKIEGVELHLKRLEAQVQSIHENLLFLKHRSSLFLPP*
xxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGETLISLDRATVLPLILLLCLACYICVVPVTEAIWLQIPSSGTKCVSEEINSNVVVLADYYVIDEAHPEHPPTVSAKVTSPYGNNLHHNENVTHGQFAFTTTEAGNYMACFWLGSNPQKVADATLGLDWRIGFSAKDWESVAKKDKxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSLFLPPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transmembrane emp24 domain-containing protein p24delta5 Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side (By similarity). Interacts with p24beta2 at endoplasmic reticulum export sites for endoplasmic reticulum exit and coupled transport to the Golgi apparatus. Once in the Golgi, interacts very efficiently with the COPI machinery for retrograde transport back to the endoplasmic reticulum.probableQ8RWM6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OLM, chain A
Confidence level:probable
Coverage over the Query: 36-134
View the alignment between query and template
View the model in PyMOL