Citrus Sinensis ID: 030082

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSLHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRSDYLRFKSENRIVPDGVNAKLLGCHGPLASRQPGRAFLHATA
ccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEcccccccccccECcccccccccccCEEEEEEEccEEEEEEEccccHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHcccECccccEEEEEcccccccccccccccccccc
***KGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSLHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRSDYLRFKSENRIVPDGVNAKLLGCHGPLASRQPGRAFLH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSLHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRSDYLRFKSENRIVPDGVNAKLLGCHGPLASRQPGRAFLHATA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L10-1 Involved in defense response to geminivirus infection.confidentQ93VT9
60S ribosomal protein L10-3 confidentQ93W22
60S ribosomal protein L10 confidentQ9SPB3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A17, chain H
Confidence level:very confident
Coverage over the Query: 1-64,76-179
View the alignment between query and template
View the model in PyMOL