Citrus Sinensis ID: 030085


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MEHSSSSNSKQRKRIAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKEVQSDDGRDHDADHHHHNNSTSSSSSIMISSSTVTLLCNLPVPDHAKHAGDALKNSASKL
ccccccccHHHHHHccccccccccccEEEEEEEccEEEEEEEEccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEEEEcEEEEccccccEEEEEEEEEEEcccEEEEEEEEEEcccEEEcccccEEEccccccccccccccEEEEEEEEEEEccccccccccHHHHHHHHHHccc
cccccccccHHHHHHHcccHHHHHHccEEEEccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccccccccEEEEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEEEEccccccccccEEEEEEEEEEEccccccHHHHHHHHHHHHHHHcc
mehssssnskqrkriavpdaplKAIGFEleeltperiIGCFrvtqnscqpfkvlHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVatpinlgkTIQVWQVRLWKVKevqsddgrdhdadhhhhnnstsssssiMISSSTVtllcnlpvpdhakhAGDALKNSASKL
mehssssnskqrkriavpdaplKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKEVQSDDGrdhdadhhhhnnstsssssIMISSSTVTLLCNLPVPDHAKHAGDALKNSASKL
MEHSSSSNSKQRKRIAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKEVQsddgrdhdadhhhhnnstsssssimisssTVTLLCNLPVPDHAKHAGDALKNSASKL
*******************APLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVK*********************************VTLLCNLP*******************
******************DAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKEVQSDDGRDH***********************VTLLCN**************KNSA***
**************IAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKEV**************************ISSSTVTLLCNLPVPDHAKHAGDALKNSASKL
******SNSKQRKRIAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKEVQSDDGRDHDADHHHHNNSTSSSSSIMISSSTVTLLCNLPVPDHAKHAGDALKNSASKL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHSSSSNSKQRKRIAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKEVQSDDGRDHDADHHHHNNSTSSSSSIMISSSTVTLLCNLPVPDHAKHAGDALKNSASKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
P14205126 Putative esterase ComA2 O yes no 0.557 0.809 0.361 3e-12
P45083138 Putative esterase HI_1161 yes no 0.502 0.666 0.414 2e-11
Q9I3A4145 Putative esterase PA1618 yes no 0.546 0.689 0.348 3e-10
P77781136 Esterase YdiI OS=Escheric N/A no 0.404 0.544 0.407 3e-10
Q9CMM9139 Putative esterase PM0788 yes no 0.415 0.546 0.410 4e-08
C9XXI1137 Proofreading thioesterase no no 0.519 0.693 0.309 1e-07
Q9KM09150 Putative esterase VC_A058 yes no 0.513 0.626 0.323 1e-07
B5BCV2137 Proofreading thioesterase no no 0.387 0.518 0.397 3e-07
A9MVB6137 Proofreading thioesterase no no 0.387 0.518 0.397 3e-07
A9ML30138 Proofreading thioesterase N/A no 0.387 0.514 0.397 3e-07
>sp|P14205|COMA2_BACSU Putative esterase ComA2 OS=Bacillus subtilis (strain 168) GN=yuxO PE=3 SV=2 Back     alignment and function desciption
 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 22  LKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAH--MASGFKR 79
           L+A+G E+ E T ER +    V   + QPF  LHGG S  +AE+ AS GA   +    + 
Sbjct: 8   LEALGIEIVENTAERCVAVMPVDHRTVQPFGYLHGGASVALAETAASAGAQNLIDHTTQA 67

Query: 80  VAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKE 124
             G+++  NHLKS + G  V+A+A P+++G+T  V+ + ++  +E
Sbjct: 68  CVGLEINANHLKSVKEGT-VKAIAEPVHIGRTTIVYHIHIYDEQE 111




Is not required for competence.
Bacillus subtilis (strain 168) (taxid: 224308)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: -
>sp|P45083|Y1161_HAEIN Putative esterase HI_1161 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1161 PE=1 SV=1 Back     alignment and function description
>sp|Q9I3A4|Y1618_PSEAE Putative esterase PA1618 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1618 PE=3 SV=1 Back     alignment and function description
>sp|P77781|YDII_ECOLI Esterase YdiI OS=Escherichia coli (strain K12) GN=ydiI PE=1 SV=1 Back     alignment and function description
>sp|Q9CMM9|Y788_PASMU Putative esterase PM0788 OS=Pasteurella multocida (strain Pm70) GN=PM0788 PE=3 SV=1 Back     alignment and function description
>sp|C9XXI1|ENTH_CROTZ Proofreading thioesterase EntH OS=Cronobacter turicensis (strain DSM 18703 / LMG 23827 / z3032) GN=entH PE=3 SV=1 Back     alignment and function description
>sp|Q9KM09|Y3380_VIBCH Putative esterase VC_A0580 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_A0580 PE=3 SV=2 Back     alignment and function description
>sp|B5BCV2|ENTH_SALPK Proofreading thioesterase EntH OS=Salmonella paratyphi A (strain AKU_12601) GN=entH PE=3 SV=1 Back     alignment and function description
>sp|A9MVB6|ENTH_SALPB Proofreading thioesterase EntH OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=entH PE=3 SV=1 Back     alignment and function description
>sp|A9ML30|ENTH_SALAR Proofreading thioesterase EntH OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=entH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
388502438163 unknown [Lotus japonicus] 0.879 0.987 0.566 9e-50
351726265183 uncharacterized protein LOC100527403 [Gl 0.836 0.836 0.587 1e-49
356531756158 PREDICTED: putative esterase HI_1161-lik 0.781 0.905 0.598 2e-49
351722108158 uncharacterized protein LOC100527631 [Gl 0.781 0.905 0.592 3e-49
15221148156 thioesterase-like protein [Arabidopsis t 0.830 0.974 0.587 2e-47
225432206172 PREDICTED: putative esterase HI_1161 iso 0.808 0.860 0.556 1e-46
297852450156 thioesterase family protein [Arabidopsis 0.765 0.897 0.591 2e-46
223948913177 unknown [Zea mays] gi|413933395|gb|AFW67 0.890 0.920 0.505 9e-45
357450257161 Esterase ydiI [Medicago truncatula] gi|3 0.868 0.987 0.522 2e-44
255556618158 acyl-CoA thioesterase, putative [Ricinus 0.852 0.987 0.538 3e-44
>gi|388502438|gb|AFK39285.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 102/180 (56%), Positives = 126/180 (70%), Gaps = 19/180 (10%)

Query: 1   MEHSSSSNSKQRKRIAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSA 60
           ME   SS+S    + A  D PL AIGFE+EEL+P+R+ G   +T   CQPFKVLHGGVSA
Sbjct: 1   MEDKPSSSSLATSKTAALDTPLHAIGFEIEELSPQRVTGRLPITLKCCQPFKVLHGGVSA 60

Query: 61  LIAESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLW 120
           +IAESLASMGAHMASG++RVAG+QL+INHLK AELGDLV A AT +N+GKT+QVW+V +W
Sbjct: 61  MIAESLASMGAHMASGYQRVAGIQLSINHLKRAELGDLVHAEATSLNVGKTVQVWEVTIW 120

Query: 121 KVKEVQSDDGRDHDADHHHHNNSTSSSSSIMISSSTVTLLCNLPVPDHAKHAGDALKNSA 180
           K+             D  +  N +      ++SSS VTL+CN+PVPDHAK AG  LK  A
Sbjct: 121 KI-------------DPSNLQNRS------LVSSSRVTLICNMPVPDHAKEAGQLLKKYA 161




Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|351726265|ref|NP_001235585.1| uncharacterized protein LOC100527403 [Glycine max] gi|255632270|gb|ACU16493.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356531756|ref|XP_003534442.1| PREDICTED: putative esterase HI_1161-like [Glycine max] Back     alignment and taxonomy information
>gi|351722108|ref|NP_001235185.1| uncharacterized protein LOC100527631 [Glycine max] gi|255632814|gb|ACU16760.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|15221148|ref|NP_175266.1| thioesterase-like protein [Arabidopsis thaliana] gi|5733877|gb|AAD49765.1|AC007932_13 F11A17.13 [Arabidopsis thaliana] gi|33589776|gb|AAQ22654.1| At1g48320 [Arabidopsis thaliana] gi|110738947|dbj|BAF01394.1| F11A17.13 [Arabidopsis thaliana] gi|332194153|gb|AEE32274.1| thioesterase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225432206|ref|XP_002269958.1| PREDICTED: putative esterase HI_1161 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297852450|ref|XP_002894106.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata] gi|297339948|gb|EFH70365.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|223948913|gb|ACN28540.1| unknown [Zea mays] gi|413933395|gb|AFW67946.1| hypothetical protein ZEAMMB73_585158 [Zea mays] Back     alignment and taxonomy information
>gi|357450257|ref|XP_003595405.1| Esterase ydiI [Medicago truncatula] gi|355484453|gb|AES65656.1| Esterase ydiI [Medicago truncatula] gi|388508678|gb|AFK42405.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255556618|ref|XP_002519343.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223541658|gb|EEF43207.1| acyl-CoA thioesterase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
TAIR|locus:2007735156 DHNAT1 "DHNA-CoA thioesterase 0.628 0.737 0.685 2.9e-44
TAIR|locus:2154354157 DHNAT2 "DHNA-CoA thioesterase 0.590 0.687 0.592 6.5e-39
UNIPROTKB|Q81XT2127 BAS4785 "ComA operon protein, 0.530 0.763 0.35 2.1e-13
TIGR_CMR|BA_5148127 BA_5148 "comA operon protein, 0.530 0.763 0.35 2.1e-13
UNIPROTKB|P77781136 ydiI "esterase" [Escherichia c 0.535 0.720 0.339 1.9e-12
UNIPROTKB|Q83D31157 CBU_0913 "Thioesterase" [Coxie 0.540 0.630 0.294 4.1e-10
TIGR_CMR|CBU_0913157 CBU_0913 "conserved hypothetic 0.540 0.630 0.294 4.1e-10
UNIPROTKB|Q4KFW2147 ydiI "Esterase YdiI" [Pseudomo 0.519 0.646 0.32 5.2e-10
UNIPROTKB|Q9KM09150 VC_A0580 "Putative esterase VC 0.480 0.586 0.333 1.8e-09
TIGR_CMR|VC_A0580150 VC_A0580 "conserved hypothetic 0.480 0.586 0.333 1.8e-09
TAIR|locus:2007735 DHNAT1 "DHNA-CoA thioesterase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 404 (147.3 bits), Expect = 2.9e-44, Sum P(2) = 2.9e-44
 Identities = 83/121 (68%), Positives = 98/121 (80%)

Query:     4 SSSSNSKQRKRIAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIA 63
             S+SSN+K     A+ D PL  +GFE +EL+P RI G   V+   CQPFKVLHGGVSALIA
Sbjct:     3 SASSNTK-----AI-DPPLHMLGFEFDELSPTRITGRLPVSPVCCQPFKVLHGGVSALIA 56

Query:    64 ESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVK 123
             ESLASMGAHMASGFKRVAG+QL+INHLKSA+LGDLV A ATP++ GKTIQVW+V+LWK  
Sbjct:    57 ESLASMGAHMASGFKRVAGIQLSINHLKSADLGDLVFAEATPVSTGKTIQVWEVKLWKTT 116

Query:   124 E 124
             +
Sbjct:   117 Q 117


GO:0009507 "chloroplast" evidence=ISM
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=ISS
GO:0047617 "acyl-CoA hydrolase activity" evidence=ISS
GO:0005777 "peroxisome" evidence=IDA
GO:0042372 "phylloquinone biosynthetic process" evidence=IMP
TAIR|locus:2154354 DHNAT2 "DHNA-CoA thioesterase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q81XT2 BAS4785 "ComA operon protein, putative" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5148 BA_5148 "comA operon protein, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P77781 ydiI "esterase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q83D31 CBU_0913 "Thioesterase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0913 CBU_0913 "conserved hypothetical protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KFW2 ydiI "Esterase YdiI" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KM09 VC_A0580 "Putative esterase VC_A0580" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0580 VC_A0580 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
PLN02322154 PLN02322, PLN02322, acyl-CoA thioesterase 2e-62
cd03443113 cd03443, PaaI_thioesterase, PaaI_thioesterase is a 4e-23
COG2050141 COG2050, PaaI, HGG motif-containing thioesterase, 5e-20
TIGR00369117 TIGR00369, unchar_dom_1, uncharacterized domain 1 6e-19
pfam0306179 pfam03061, 4HBT, Thioesterase superfamily 7e-14
PRK10293136 PRK10293, PRK10293, acyl-CoA esterase; Provisional 6e-13
PRK10254137 PRK10254, PRK10254, thioesterase; Provisional 1e-09
cd03440100 cd03440, hot_dog, The hotdog fold was initially id 2e-09
TIGR02286114 TIGR02286, PaaD, phenylacetic acid degradation pro 4e-07
>gnl|CDD|177956 PLN02322, PLN02322, acyl-CoA thioesterase Back     alignment and domain information
 Score =  189 bits (482), Expect = 2e-62
 Identities = 99/177 (55%), Positives = 123/177 (69%), Gaps = 25/177 (14%)

Query: 4   SSSSNSKQRKRIAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIA 63
           S+SSN+K        D PL  +GFE +EL+P R+ G   V+   CQPFKVLHGGVSALIA
Sbjct: 1   SASSNTKAI------DPPLHMLGFEFDELSPTRVTGRLPVSPMCCQPFKVLHGGVSALIA 54

Query: 64  ESLASMGAHMASGFKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVK 123
           ESLAS+GAHMASGFKRVAG+QL+INHLKSA+LGDLV A ATP++ GKTIQVW+V+LWK  
Sbjct: 55  ESLASLGAHMASGFKRVAGIQLSINHLKSADLGDLVFAEATPVSTGKTIQVWEVKLWKTT 114

Query: 124 EVQSDDGRDHDADHHHHNNSTSSSSSIMISSSTVTLLCNLPVPDHAKHAGDALKNSA 180
           +                      ++ I+ISSS VTL+CNLP+PD+AK A + L+  A
Sbjct: 115 D-------------------KDKANKILISSSRVTLICNLPIPDNAKDAANMLRMQA 152


Length = 154

>gnl|CDD|239527 cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>gnl|CDD|224961 COG2050, PaaI, HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|161843 TIGR00369, unchar_dom_1, uncharacterized domain 1 Back     alignment and domain information
>gnl|CDD|217345 pfam03061, 4HBT, Thioesterase superfamily Back     alignment and domain information
>gnl|CDD|182360 PRK10293, PRK10293, acyl-CoA esterase; Provisional Back     alignment and domain information
>gnl|CDD|182337 PRK10254, PRK10254, thioesterase; Provisional Back     alignment and domain information
>gnl|CDD|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E Back     alignment and domain information
>gnl|CDD|131339 TIGR02286, PaaD, phenylacetic acid degradation protein PaaD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
PLN02322154 acyl-CoA thioesterase 100.0
PRK10254137 thioesterase; Provisional 100.0
PRK10293136 acyl-CoA esterase; Provisional 100.0
PRK11688154 hypothetical protein; Provisional 99.96
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 99.96
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 99.96
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 99.95
KOG3328148 consensus HGG motif-containing thioesterase [Gener 99.94
TIGR02447138 yiiD_Cterm thioesterase domain, putative. This fam 99.91
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 99.86
PF14539132 DUF4442: Domain of unknown function (DUF4442); PDB 99.76
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 99.71
PRK10694133 acyl-CoA esterase; Provisional 99.66
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 99.66
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought 99.64
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 99.59
PRK04424185 fatty acid biosynthesis transcriptional regulator; 99.46
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 99.39
cd03440100 hot_dog The hotdog fold was initially identified i 99.18
PLN02647 437 acyl-CoA thioesterase 99.16
PF09500144 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); In 99.16
PLN02647437 acyl-CoA thioesterase 99.08
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 98.84
PF13622 255 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 98.83
cd0344594 Thioesterase_II_repeat2 Thioesterase II (TEII) is 98.81
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 98.79
KOG4781237 consensus Uncharacterized conserved protein [Funct 98.71
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 98.66
COG0824137 FcbC Predicted thioesterase [General function pred 98.65
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 98.58
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 98.33
TIGR00189 271 tesB acyl-CoA thioesterase II. Subunit: homotetram 98.32
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 98.3
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier 98.3
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 98.22
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 97.96
PRK10526 286 acyl-CoA thioesterase II; Provisional 97.92
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 97.9
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 97.82
PLN02868 413 acyl-CoA thioesterase family protein 97.81
TIGR01750140 fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd 97.8
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 97.75
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protei 97.75
KOG2763357 consensus Acyl-CoA thioesterase [Lipid transport a 97.72
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 97.7
COG4109432 Predicted transcriptional regulator containing CBS 97.69
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro 97.69
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belo 97.65
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr 97.61
PRK08190 466 bifunctional enoyl-CoA hydratase/phosphate acetylt 97.58
cd01289138 FabA_like Domain of unknown function, appears to b 97.54
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the M 97.49
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro 97.4
COG5496130 Predicted thioesterase [General function predictio 97.38
cd03444104 Thioesterase_II_repeat1 Thioesterase II (TEII) is 97.34
PLN02370 419 acyl-ACP thioesterase 97.2
PF13622255 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 97.16
PRK13188464 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl 97.06
TIGR00189271 tesB acyl-CoA thioesterase II. Subunit: homotetram 97.03
PF07977138 FabA: FabA-like domain; InterPro: IPR013114 Fatty 96.84
cd01287150 FabA FabA, beta-hydroxydecanoyl-acyl carrier prote 96.44
KOG3016 294 consensus Acyl-CoA thioesterase [Lipid transport a 96.44
COG2030159 MaoC Acyl dehydratase [Lipid metabolism] 96.1
PF01575122 MaoC_dehydratas: MaoC like domain; InterPro: IPR00 96.0
PRK13693142 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Pro 95.98
cd03448122 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold 95.89
cd03450149 NodN NodN (nodulation factor N) contains a single 95.79
KOG2763 357 consensus Acyl-CoA thioesterase [Lipid transport a 95.75
PRK10526286 acyl-CoA thioesterase II; Provisional 95.64
PF13452132 MaoC_dehydrat_N: N-terminal half of MaoC dehydrata 95.44
TIGR02278663 PaaN-DH phenylacetic acid degradation protein paaN 95.14
PF01643 261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 95.09
PRK05174172 3-hydroxydecanoyl-(acyl carrier protein) dehydrata 95.03
PLN02864310 enoyl-CoA hydratase 94.87
PRK11563675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 94.77
TIGR01749169 fabA beta-hydroxyacyl-[acyl carrier protein] dehyd 94.24
COG1946 289 TesB Acyl-CoA thioesterase [Lipid metabolism] 94.24
PLN02868413 acyl-CoA thioesterase family protein 94.09
COG0764147 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl ca 93.18
PF03756132 AfsA: A-factor biosynthesis hotdog domain; InterPr 92.41
PLN02864 310 enoyl-CoA hydratase 90.89
COG1946289 TesB Acyl-CoA thioesterase [Lipid metabolism] 90.67
PF02551131 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IP 88.95
PF14765295 PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_ 86.93
PF01643261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 81.04
>PLN02322 acyl-CoA thioesterase Back     alignment and domain information
Probab=100.00  E-value=1.4e-34  Score=232.78  Aligned_cols=146  Identities=64%  Similarity=1.044  Sum_probs=130.1

Q ss_pred             CCCCchhhhcCCEEEEEeCCEEEEEEEcCCCCcCCCCcccHHHHHHHHHHHHHHHHHHhcCCceeEEEEEeEEEecCCCC
Q 030085           16 AVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGFKRVAGVQLTINHLKSAEL   95 (183)
Q Consensus        16 ~~~~p~~~~Lg~~~~~~~~g~v~~~m~v~~~~~Np~G~lHGG~~a~LaD~A~g~a~~~~~~~~~~vTv~l~i~flrpa~~   95 (183)
                      ...|||+++||+++.++++|+++++||++++|+||+|.+|||++++|+|+++++++....++..++|++++||||||++.
T Consensus         7 ~~~dpf~~~LGi~l~ei~~G~~~~~m~v~~~~~N~~G~vHGGv~atLaDta~g~A~~~~~~~~~~vTiel~infLrpa~~   86 (154)
T PLN02322          7 KAIDPPLHMLGFEFDELSPTRVTGRLPVSPMCCQPFKVLHGGVSALIAESLASLGAHMASGFKRVAGIQLSINHLKSADL   86 (154)
T ss_pred             cccchHHHHCCCEEEEEECCEEEEEEECCHHHcCCCCCccHHHHHHHHHHHHHHHHhhccCCCceEEEEEEEEEeccCCC
Confidence            35799999999999999999999999999999999999999999999999999888654444578999999999999999


Q ss_pred             CCEEEEEEEEEEeCCcEEEEEEEEEEcccccCCCCCCCCCCCCcCCCCCCCCCCcEEEEEEEEEEEecCCCCccchhHHH
Q 030085           96 GDLVRAVATPINLGKTIQVWQVRLWKVKEVQSDDGRDHDADHHHHNNSTSSSSSIMISSSTVTLLCNLPVPDHAKHAGDA  175 (183)
Q Consensus        96 Gd~l~a~a~vi~~Gr~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lvA~~t~T~~~~~p~p~~~~~~~~~  175 (183)
                      |+.|+|+|+++|.|||+++|+++||++....|                   +++++||.+++|++++.|+|+.+|++++-
T Consensus        87 G~~L~Aea~vv~~Gr~~~~~ev~V~~~~~~~~-------------------~~~~lva~a~~T~~~~~~~~~~~~~~~~~  147 (154)
T PLN02322         87 GDLVFAEATPVSTGKTIQVWEVKLWKTTDKDK-------------------ANKILISSSRVTLICNLPIPDNAKDAANM  147 (154)
T ss_pred             CCEEEEEEEEEecCCCEEEEEEEEEECCCCcc-------------------cCCeEEEEEEEEEEEccCChhhhhhhHHH
Confidence            98999999999999999999999998321000                   23899999999999999999999999999


Q ss_pred             HHhhh
Q 030085          176 LKNSA  180 (183)
Q Consensus       176 ~~~~~  180 (183)
                      |+--+
T Consensus       148 ~~~~~  152 (154)
T PLN02322        148 LRMQA  152 (154)
T ss_pred             HHHhh
Confidence            87543



>PRK10254 thioesterase; Provisional Back     alignment and domain information
>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] Back     alignment and domain information
>TIGR02447 yiiD_Cterm thioesterase domain, putative Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>PF09500 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B Back     alignment and domain information
>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>KOG4781 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR00189 tesB acyl-CoA thioesterase II Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>KOG2763 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>COG5496 Predicted thioesterase [General function prediction only] Back     alignment and domain information
>cd03444 Thioesterase_II_repeat1 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>PLN02370 acyl-ACP thioesterase Back     alignment and domain information
>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>TIGR00189 tesB acyl-CoA thioesterase II Back     alignment and domain information
>PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] Back     alignment and domain information
>cd01287 FabA FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site Back     alignment and domain information
>KOG3016 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] Back     alignment and domain information
>COG2030 MaoC Acyl dehydratase [Lipid metabolism] Back     alignment and domain information
>PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes Back     alignment and domain information
>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional Back     alignment and domain information
>cd03448 HDE_HSD HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins Back     alignment and domain information
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>KOG2763 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10526 acyl-CoA thioesterase II; Provisional Back     alignment and domain information
>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information
>PRK05174 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated Back     alignment and domain information
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01749 fabA beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA Back     alignment and domain information
>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>COG0764 FabA 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism] Back     alignment and domain information
>PF03756 AfsA: A-factor biosynthesis hotdog domain; InterPro: IPR005509 The AfsA family are key enzymes in A-factor biosynthesis, which is essential for streptomycin production and resistance Back     alignment and domain information
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information
>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism] Back     alignment and domain information
>PF02551 Acyl_CoA_thio: Acyl-CoA thioesterase; InterPro: IPR003703 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH) Back     alignment and domain information
>PF14765 PS-DH: Polyketide synthase dehydratase; PDB: 3KG7_D 3KG9_A 3KG8_B 3HRR_A 3HRQ_A 3EL6_A 3KG6_B 2VZ8_A 2VZ9_A Back     alignment and domain information
>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1sc0_A138 X-Ray Structure Of Yb61_haein Northeast Structural 2e-12
2b6e_A146 X-Ray Crystal Structure Of Protein Hi1161 From Haem 2e-12
1sbk_A144 X-Ray Structure Of Ydii_ecoli Northeast Structural 2e-11
1vh5_A148 Crystal Structure Of A Putative Thioesterase Length 2e-11
1vh9_A149 Crystal Structure Of A Putative Thioesterase Length 1e-07
3r3d_A151 Crystal Structure Of Arthrobacter Sp. Strain Su 4-H 1e-04
1q4s_A151 Crystal Structure Of Arthrobacter Sp. Strain Su 4-H 2e-04
3r34_A151 Crystal Structure Of Arthrobacter Sp. Strain Su 4-H 5e-04
3r36_B151 Crystal Structure Of Arthrobacter Sp. Strain Su 4-H 6e-04
>pdb|1SC0|A Chain A, X-Ray Structure Of Yb61_haein Northeast Structural Genomics Consortium Target Ir63 Length = 138 Back     alignment and structure

Iteration: 1

Score = 68.2 bits (165), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 39/102 (38%), Positives = 57/102 (55%), Gaps = 2/102 (1%) Query: 19 DAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASM-GAHMASGF 77 ++ + +G E+ + I V + QPF VLHGGVS +AE++ S+ G+ Sbjct: 18 NSAVSHLGIEISAFGEDWIEATXPVDHRTXQPFGVLHGGVSVALAETIGSLAGSLCLEEG 77 Query: 78 KRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRL 119 K V G+ + NHL+ G V A ATPINLG+ IQVWQ+ + Sbjct: 78 KTVVGLDINANHLRPVRSGK-VTARATPINLGRNIQVWQIDI 118
>pdb|2B6E|A Chain A, X-Ray Crystal Structure Of Protein Hi1161 From Haemophilus Influenzae. Northeast Structural Genomics Consortium Target Ir63. Length = 146 Back     alignment and structure
>pdb|1SBK|A Chain A, X-Ray Structure Of Ydii_ecoli Northeast Structural Genomics Consortium Target Er29. Length = 144 Back     alignment and structure
>pdb|1VH5|A Chain A, Crystal Structure Of A Putative Thioesterase Length = 148 Back     alignment and structure
>pdb|1VH9|A Chain A, Crystal Structure Of A Putative Thioesterase Length = 149 Back     alignment and structure
>pdb|3R3D|A Chain A, Crystal Structure Of Arthrobacter Sp. Strain Su 4-Hydroxybenzoyl Coa Thioesterase Mutant T77s Complexed With 4-Hydroxyphenacyl Coa Length = 151 Back     alignment and structure
>pdb|1Q4S|A Chain A, Crystal Structure Of Arthrobacter Sp. Strain Su 4-Hydroxybenzoyl Coa Thioesterase Complexed With Coa And 4-Hydroxybenzoic Acid Length = 151 Back     alignment and structure
>pdb|3R34|A Chain A, Crystal Structure Of Arthrobacter Sp. Strain Su 4-Hydroxybenzoyl Coa Thioesterase Mutant E73d Complexed With Coa Length = 151 Back     alignment and structure
>pdb|3R36|B Chain B, Crystal Structure Of Arthrobacter Sp. Strain Su 4-Hydroxybenzoyl Coa Thioesterase Mutant E73q Complexed With 4-Hydroxybenzoic Acid Length = 151 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1o0i_A138 Hypothetical protein HI1161; structural genomics, 2e-25
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 1e-23
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 2e-23
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 3e-23
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 2e-21
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 2e-21
1zki_A133 Hypothetical protein PA5202; structural genomics, 4e-21
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 2e-20
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 5e-20
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 2e-19
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 2e-19
2qwz_A159 Phenylacetic acid degradation-related protein; put 2e-19
3e1e_A141 Thioesterase family protein; structural genomics, 1e-17
2h4u_A145 Thioesterase superfamily member 2; structural geno 1e-15
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 2e-15
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 2e-14
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 6e-14
2pim_A141 Phenylacetic acid degradation-related protein; thi 5e-12
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 1e-11
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 1e-10
3hdu_A157 Putative thioesterase; structural genomics, joint 1e-10
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 1e-10
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 6e-09
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1yoc_A147 Hypothetical protein PA1835; structural genomics, 2e-04
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 1sc0_A 2b6e_A 3lz7_A Length = 138 Back     alignment and structure
 Score = 94.5 bits (235), Expect = 2e-25
 Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 2/104 (1%)

Query: 18  PDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHM-ASG 76
            ++ +  +G E+     + I     V   + QPF VLHGGVS  +AE++ S+   +    
Sbjct: 17  SNSAVSHLGIEISAFGEDWIEATMPVDHRTMQPFGVLHGGVSVALAETIGSLAGSLCLEE 76

Query: 77  FKRVAGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLW 120
            K V G+ +  NHL+    G  V A ATPINLG+ IQVWQ+ + 
Sbjct: 77  GKTVVGLDINANHLRPVRSGK-VTARATPINLGRNIQVWQIDIR 119


>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Length = 149 Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} Length = 144 Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Length = 148 Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Length = 151 Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Length = 136 Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Length = 133 Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Length = 146 Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Length = 151 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Length = 176 Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Length = 163 Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Length = 159 Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Length = 141 Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Length = 145 Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} PDB: 2f0x_A* 2cy9_A Length = 148 Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} Length = 144 Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Length = 142 Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Length = 141 Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Length = 158 Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Length = 148 Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Length = 157 Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Length = 164 Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Length = 131 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Length = 145 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Length = 147 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
1sc0_A138 Hypothetical protein HI1161; structural genomics, 100.0
3e1e_A141 Thioesterase family protein; structural genomics, 99.97
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 99.97
1o0i_A138 Hypothetical protein HI1161; structural genomics, 99.97
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 99.97
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 99.97
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 99.97
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 99.97
3hdu_A157 Putative thioesterase; structural genomics, joint 99.96
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 99.96
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 99.96
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 99.96
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 99.96
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 99.96
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 99.96
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 99.96
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 99.95
1yoc_A147 Hypothetical protein PA1835; structural genomics, 99.95
2h4u_A145 Thioesterase superfamily member 2; structural geno 99.95
2pim_A141 Phenylacetic acid degradation-related protein; thi 99.94
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 99.94
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 99.94
1sh8_A154 Hypothetical protein PA5026; structural genomics, 99.94
1zki_A133 Hypothetical protein PA5202; structural genomics, 99.94
2qwz_A159 Phenylacetic acid degradation-related protein; put 99.93
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 99.92
1t82_A155 Hypothetical acetyltransferase; structural genomic 99.92
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 99.92
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 99.91
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 99.91
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 99.9
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 99.89
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 99.86
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 99.86
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 99.85
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 99.81
3lmb_A165 Uncharacterized protein; protein OLEI01261, unknow 99.79
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 99.78
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 99.77
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 99.76
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 99.75
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 99.75
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 99.73
4a0z_A190 Transcription factor FAPR; lipid homeostasis; HET: 99.73
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 99.73
3b7k_A 333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 99.72
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 99.69
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 99.69
2cwz_A141 Thioesterase family protein; structural genomics, 99.68
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 99.67
2gvh_A 288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 99.66
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 99.6
3bbj_A 272 Putative thioesterase II; structural genomics, joi 99.54
1njk_A156 Hypothetical protein YBAW; structural genomics, th 99.53
2cye_A133 TTHA1846, putative thioesterase; structural genomi 99.52
2fuj_A137 Conserved hypothetical protein; structural genomic 99.44
2q78_A153 Uncharacterized protein; structural genomics, join 99.43
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 99.38
3ck1_A150 Putative thioesterase; structural genomics, joint 99.38
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 99.38
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 99.38
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 99.38
2hlj_A157 Hypothetical protein; putative thioesterase, struc 99.32
1z54_A132 Probable thioesterase; hypothetical protein, struc 99.32
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 99.3
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 99.29
2gf6_A135 Conserved hypothetical protein; putative thioester 99.28
2ali_A158 Hypothetical protein PA2801; structural genomics, 99.28
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 99.24
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 99.24
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 99.22
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 99.2
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 99.16
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 99.16
3r87_A135 Putative uncharacterized protein; unknown function 99.14
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 99.07
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 99.02
3cjy_A 259 Putative thioesterase; YP_496845.1, structural gen 98.98
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 98.95
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 98.89
3rqb_A 275 Uncharacterized protein; structural genomics, PSI- 98.89
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 98.74
2b3n_A159 Hypothetical protein AF1124; structural genomics, 98.54
2own_A 262 Putative oleoyl-[acyl-carrier protein] thioestera; 98.53
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural gen 98.48
1c8u_A 285 Acyl-COA thioesterase II; internal repeats, hydrol 98.38
1tbu_A118 Peroxisomal acyl-coenzyme A thioester hydrolase 1; 98.33
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd 98.31
3u0a_A 285 Acyl-COA thioesterase II TESB2; structural genomic 98.3
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 98.28
4gak_A 250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 98.26
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 98.26
3rd7_A 286 Acyl-COA thioesterase; seattle structur genomics c 98.26
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 98.19
2own_A262 Putative oleoyl-[acyl-carrier protein] thioestera; 98.13
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, bet 98.12
4i83_A152 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; 98.08
4ffu_A176 Oxidase; structural genomics, protein structure in 97.99
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d 97.95
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 97.8
4h4g_A160 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 97.75
3k67_A159 Putative dehydratase AF1124; hypothetical protein 97.66
3rqb_A275 Uncharacterized protein; structural genomics, PSI- 97.43
4e3e_A 352 MAOC domain protein dehydratase; structural genomi 97.42
2bi0_A 337 Hypothetical protein RV0216; conserved hypothetica 97.12
2ess_A248 Acyl-ACP thioesterase; NP_810988.1, structural gen 97.03
3q62_A175 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 96.93
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG 96.88
2cf2_C342 Fatty acid synthase, DH domain; transferase, fatty 96.88
3cjy_A259 Putative thioesterase; YP_496845.1, structural gen 96.82
3u0a_A285 Acyl-COA thioesterase II TESB2; structural genomic 96.8
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase 96.8
1c8u_A285 Acyl-COA thioesterase II; internal repeats, hydrol 96.53
4b0b_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 96.5
3rd7_A286 Acyl-COA thioesterase; seattle structur genomics c 96.39
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 96.37
3esi_A129 Uncharacterized protein; protein from erwinia caro 95.91
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 95.85
4gak_A250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 95.72
2cf2_C 342 Fatty acid synthase, DH domain; transferase, fatty 94.75
2bi0_A337 Hypothetical protein RV0216; conserved hypothetica 94.61
3bbj_A272 Putative thioesterase II; structural genomics, joi 94.19
1pn2_A 280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 93.79
4e3e_A352 MAOC domain protein dehydratase; structural genomi 93.73
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 93.07
3khp_A 311 MAOC family protein; dehydrogenase, oxidoreductase 92.98
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 90.47
1s9c_A 298 Peroxisomal multifunctional enzyme type 2; hot-DOG 89.71
3kh8_A 332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 89.56
4b8u_A171 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; 86.9
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 81.9
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
Probab=100.00  E-value=2.9e-32  Score=212.04  Aligned_cols=129  Identities=32%  Similarity=0.555  Sum_probs=117.1

Q ss_pred             chhhccccCCCCchhhhcCCEEEEEeCCEEEEEEEcCCCCcCCCCcccHHHHHHHHHHHHHHHHHHhcCC-ceeEEEEEe
Q 030085            8 NSKQRKRIAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASGF-KRVAGVQLT   86 (183)
Q Consensus         8 ~~~~~~~~~~~~p~~~~Lg~~~~~~~~g~v~~~m~v~~~~~Np~G~lHGG~~a~LaD~A~g~a~~~~~~~-~~~vTv~l~   86 (183)
                      ...+.|.+ ..++|.++||++++++++|+++++||++++|+||+|.+|||++++|+|.++++|+....+. ..++|++++
T Consensus         8 ~le~ln~~-~~~~~~~~LGi~~~~~~~g~~~~~~~v~~~~~n~~G~~HGG~~~~l~D~a~~~a~~~~~~~~~~~vt~~l~   86 (138)
T 1sc0_A            8 TLENLNQL-CSNSAVSHLGIEISAFGEDWIEATMPVDHRTMQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDIN   86 (138)
T ss_dssp             CHHHHHHH-TCSSHHHHTTCEEEEECSSCEEEEEECSTTTBCTTSSBCHHHHHHHHHHHHHHHHHHTSCTTCEEEEEEEE
T ss_pred             CHHHHHhh-CcccHHHhcCCEEEEEeCCEEEEEEEcCHHHcCCCCcCcHHHHHHHHHHHHHHHHHHhCCCCceeeeeEEE
Confidence            34455554 4578999999999999999999999999999999999999999999999999998877654 678999999


Q ss_pred             EEEecCCCCCCEEEEEEEEEEeCCcEEEEEEEEEEcccccCCCCCCCCCCCCcCCCCCCCCCCcEEEEEEEEEEEecC
Q 030085           87 INHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKEVQSDDGRDHDADHHHHNNSTSSSSSIMISSSTVTLLCNLP  164 (183)
Q Consensus        87 i~flrpa~~Gd~l~a~a~vi~~Gr~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lvA~~t~T~~~~~p  164 (183)
                      +|||||++.| .++++|+++|.|||+++++++|+|                         ++|++||++++|+++ +|
T Consensus        87 i~flrpa~~g-~l~a~a~v~~~Gr~~~~~~~~i~d-------------------------~~g~lvA~a~~T~~i-l~  137 (138)
T 1sc0_A           87 ANHLRPVRSG-KVTARATPINLGRNIQVWQIDIRT-------------------------EENKLCCVSRLTLSV-IN  137 (138)
T ss_dssp             EEECSCCCSS-EEEEEEEEEEECSSEEEEEEEEEC-------------------------TTSCEEEEEEEEEEE-EC
T ss_pred             EEEEccCCCC-cEEEEEEEEEcCCCEEEEEEEEEc-------------------------CCCCEEEEEEEEEEE-Ee
Confidence            9999999988 799999999999999999999998                         779999999999994 44



>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0 Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A Back     alignment and structure
>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>3q62_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; structural genomics, center for structural genomics of infec diseases, csgid; HET: MES; 1.40A {Yersinia pseudotuberculosis} SCOP: d.38.1.2 PDB: 1mka_A* 1mkb_A Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>4b0b_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, bacterial virulence, drug DI; HET: 54F; 1.90A {Pseudomonas aeruginosa} PDB: 4b0c_A* 4b0j_A* 4b8u_A* 4b0i_A* Back     alignment and structure
>3rd7_A Acyl-COA thioesterase; seattle structur genomics center for infectious disease, ssgcid, hydrolase; 1.95A {Mycobacterium avium} Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
>3esi_A Uncharacterized protein; protein from erwinia carotovora subsp. atroseptica (pectobacterium atrosepticum), structural genomics; 2.50A {Pectobacterium atrosepticum} Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
>4b8u_A 3-hydroxydecanoyl-[acyl-carrier-protein] dehydrat; lyase, fatty acid biosynthesis, inhibitor, bacterial virulen discovery; HET: IBK; 2.76A {Pseudomonas aeruginosa} Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d1vh9a_138 d.38.1.5 (A:) Hypothetical protein YbdB {Escherich 1e-15
d2f0xa1136 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Hum 2e-15
d2fs2a1131 d.38.1.5 (A:1-131) Phenylacetic acid degradation p 1e-14
d1sc0a_137 d.38.1.5 (A:) Hypothetical protein HI1161 {Haemoph 3e-14
d1vh5a_138 d.38.1.5 (A:) Hypothetical protein YdiI {Escherich 6e-14
d1zkia1126 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Ps 1e-13
d1wlua1116 d.38.1.5 (A:2-117) Phenylacetic acid degradation p 4e-13
d2hboa1142 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {C 3e-11
d1yoca1145 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Ps 2e-10
d1ixla_130 d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeo 8e-10
d1q4ua_140 d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {A 2e-09
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: PaaI/YdiI-like
domain: Hypothetical protein YbdB
species: Escherichia coli [TaxId: 562]
 Score = 68.0 bits (166), Expect = 1e-15
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 2/100 (2%)

Query: 22  LKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAH-MASGFKRV 80
           +  +G     L  + +     V   + QPF +LHGG SA +AE+L SM    M    + V
Sbjct: 22  VAHLGIVYTRLGDDVLEAEMPVDTRTHQPFGLLHGGASAALAETLGSMAGFMMTRDGQCV 81

Query: 81  AGVQLTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLW 120
            G +L   H +    G + R V  P++LG+  Q W++ ++
Sbjct: 82  VGTELNATHHRPVSEGKV-RGVCQPLHLGRQNQSWEIVVF 120


>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Length = 131 Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Length = 137 Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Length = 126 Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Length = 116 Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Length = 142 Back     information, alignment and structure
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Length = 145 Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 130 Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 99.98
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 99.97
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 99.97
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 99.97
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 99.97
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 99.97
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 99.97
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 99.97
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 99.95
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 99.94
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginos 99.92
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginos 99.91
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensi 99.9
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 99.87
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 99.87
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 99.75
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 99.73
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 99.72
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 99.7
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 99.63
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 99.12
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 99.03
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 99.02
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 98.98
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 98.97
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 98.97
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 98.88
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 98.87
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 98.87
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 98.83
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 98.81
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 98.81
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 98.76
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 98.75
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 98.74
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 98.68
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 98.6
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 98.43
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 98.43
d1tbua1104 Peroxisomal long-chain acyl-CoA thioesterase 1, TE 98.38
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 98.08
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Arc 97.89
d1c8ua1114 Thioesterase II (TesB) {Escherichia coli [TaxId: 5 97.8
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium 97.59
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobu 97.59
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria 97.53
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo 97.5
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 97.44
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium 96.95
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tubercu 96.83
d1c8ua2171 Thioesterase II (TesB) {Escherichia coli [TaxId: 5 96.7
d1pn2a2124 2-enoyl-coa hydratase domain of multifunctional pe 96.03
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional pe 95.83
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional pe 95.07
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional pe 94.61
d1mkaa_171 beta-Hydroxydecanol thiol ester dehydrase {Escheri 93.4
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: PaaI/YdiI-like
domain: Hypothetical protein YbdB
species: Escherichia coli [TaxId: 562]
Probab=99.98  E-value=1.9e-31  Score=205.40  Aligned_cols=130  Identities=24%  Similarity=0.388  Sum_probs=117.1

Q ss_pred             CCchhhccccCCCCchhhhcCCEEEEEeCCEEEEEEEcCCCCcCCCCcccHHHHHHHHHHHHHHHHHHhcC-CceeEEEE
Q 030085            6 SSNSKQRKRIAVPDAPLKAIGFELEELTPERIIGCFRVTQNSCQPFKVLHGGVSALIAESLASMGAHMASG-FKRVAGVQ   84 (183)
Q Consensus         6 ~~~~~~~~~~~~~~p~~~~Lg~~~~~~~~g~v~~~m~v~~~~~Np~G~lHGG~~a~LaD~A~g~a~~~~~~-~~~~vTv~   84 (183)
                      +-...+.+++ .+++|.++||++++++++|+++++|++.++++||.|.+|||++++|+|.++++|+....+ +..++|++
T Consensus         7 ~~tl~~l~~~-~~~~~~~~LGi~~~~~~~g~~~~~~~v~~~~~n~~g~~HGG~iatl~D~~~~~a~~~~~~~~~~~vT~~   85 (138)
T d1vh9a_           7 HLTLDELNAT-SDNTMVAHLGIVYTRLGDDVLEAEMPVDTRTHQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTE   85 (138)
T ss_dssp             CCCHHHHHHT-STTSHHHHTTCEEEEECSSCEEEEEECSTTTBCTTSSBCHHHHHHHHHHHHHHHHHTTCCTTCCEEEEE
T ss_pred             CCCHHHHHhh-CcchHHHhcCCEEEEEeCCEEEEEEEcCHHHcCCCCceecchhhhhHHHHHHHHHHhhccccccccccc
Confidence            3345556665 457899999999999999999999999999999999999999999999999999877654 46789999


Q ss_pred             EeEEEecCCCCCCEEEEEEEEEEeCCcEEEEEEEEEEcccccCCCCCCCCCCCCcCCCCCCCCCCcEEEEEEEEEEEe
Q 030085           85 LTINHLKSAELGDLVRAVATPINLGKTIQVWQVRLWKVKEVQSDDGRDHDADHHHHNNSTSSSSSIMISSSTVTLLCN  162 (183)
Q Consensus        85 l~i~flrpa~~Gd~l~a~a~vi~~Gr~~~~~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lvA~~t~T~~~~  162 (183)
                      ++++|+||++.| .++++|+++|.||++++++++++|                         ++|++||++++|++++
T Consensus        86 l~v~flrp~~~g-~l~a~a~v~~~Gr~~~~~e~~i~d-------------------------~~g~lvA~a~~T~~il  137 (138)
T d1vh9a_          86 LNATHHRPVSEG-KVRGVCQPLHLGRQNQSWEIVVFD-------------------------EQGRRCCTCRLGTAVL  137 (138)
T ss_dssp             EEEEECSCCCSS-EEEEEEEEEEECSSEEEEEEEEEC-------------------------TTSCEEEEEEEEEEEC
T ss_pred             cceeEEeccCCC-eEEEEEEEEEcCCCEEEEEEEEEc-------------------------CCCCEEEEEeEEEEEE
Confidence            999999999988 699999999999999999999998                         7899999999999953



>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure