Citrus Sinensis ID: 030091


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MEATSLISLSSFAAGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
ccccccccHHHHccccccccccEEEcccccHHHHHccccccccccHHHHHHHHHHHccHHHcccccccccccccccHHHHHHHHHcccEEEEcccHHHHHcccccccEEccccccccccccccHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHcccccccccHHHHHHHHHccccccc
ccccccccccHHcccccccccccEEccccccccEEEEHHcccccccEEEEcccccccHHHHHccccccccccccccHHHHHHHHHcccEEEEEccHHHHHcccccccEEEcccccccccccccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccccEEccHHHHHHHHHccccccc
MEATSLISLssfaagasslppvlcphgnnrrgllSLTVdqqrcdnigfisskilsfcpkaslrgnleavgvptsvPVRVAHELLQAGhryldvrtpeefsaghatgainvpymyrvgsgmtknLKFVEEVSTRFrkhdeiigcqsgkrSMMAATDLLNAGFAGITDIAGGFAawrqnglptep
MEATSLISLSSFAAGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVStrfrkhdeiigcqsgkrSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
MEATslislssfaagasslPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
********************PVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWR********
*****LISLSSFAAGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLR***********VPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT**
********LSSFAAGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
*************AGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEATSLISLSSFAAGASSLPPVLCPHGNNRRGLLSLTVDQQRCDNIGFISSKILSFCPKASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEIIGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
Q38853182 Rhodanese-like domain-con yes no 0.939 0.945 0.539 2e-46
P27626183 Senescence-associated pro N/A no 0.606 0.606 0.696 6e-42
Q39129120 Thiosulfate sulfurtransfe no no 0.612 0.933 0.681 3e-39
Q9FKW8136 Thiosulfate sulfurtransfe no no 0.584 0.786 0.454 2e-22
Q8RUD6169 Rhodanese-like domain-con no no 0.579 0.627 0.392 3e-18
F4IPI4156 Rhodanese-like domain-con no no 0.759 0.891 0.326 7e-15
Q94A65224 Rhodanese-like domain-con no no 0.590 0.482 0.303 4e-07
Q7MQ91106 Thiosulfate sulfurtransfe yes no 0.530 0.915 0.302 2e-06
Q8DD53106 Thiosulfate sulfurtransfe yes no 0.530 0.915 0.302 2e-06
A4VHH7109 Thiosulfate sulfurtransfe yes no 0.497 0.834 0.284 2e-06
>sp|Q38853|STR15_ARATH Rhodanese-like domain-containing protein 15, chloroplastic OS=Arabidopsis thaliana GN=STR15 PE=2 SV=1 Back     alignment and function desciption
 Score =  185 bits (469), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 103/191 (53%), Positives = 125/191 (65%), Gaps = 19/191 (9%)

Query: 1   MEATSLISLSSFAAGASSLPPVLCPHGN------NRRGLLSLTVDQQRCDNIGFISSKIL 54
           ME T+  + S     +S++ P L   G+       RRG++   V   R  N  +  +   
Sbjct: 1   METTAFNTTSRIGNWSSAISPPLQTCGSFKCQLPTRRGVI---VADLRNSNFRWRKATTT 57

Query: 55  SFCPKASLRGNL--EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPY 112
           S       RGN+  EAV +PTSVPVRVA EL QAG+RYLDVRTP+EFS GH T AINVPY
Sbjct: 58  S-------RGNVAAEAVKIPTSVPVRVARELAQAGYRYLDVRTPDEFSIGHPTRAINVPY 110

Query: 113 MYRVGSGMTKNLKFVEEVSTRFRKHDE-IIGCQSGKRSMMAATDLLNAGFAGITDIAGGF 171
           MYRVGSGM KN  F+ +VS+ FRKHDE IIGC+SG+ S MA+TDLL AGF  ITDIAGG+
Sbjct: 111 MYRVGSGMVKNPSFLRQVSSHFRKHDEIIIGCESGQMSFMASTDLLTAGFTAITDIAGGY 170

Query: 172 AAWRQNGLPTE 182
            AW +N LP E
Sbjct: 171 VAWTENELPVE 181





Arabidopsis thaliana (taxid: 3702)
>sp|P27626|DIN1_RAPSA Senescence-associated protein DIN1 OS=Raphanus sativus GN=DIN1 PE=2 SV=1 Back     alignment and function description
>sp|Q39129|STR16_ARATH Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana GN=STR16 PE=1 SV=2 Back     alignment and function description
>sp|Q9FKW8|STR18_ARATH Thiosulfate sulfurtransferase 18 OS=Arabidopsis thaliana GN=STR18 PE=1 SV=1 Back     alignment and function description
>sp|Q8RUD6|STR19_ARATH Rhodanese-like domain-containing protein 19, mitochondrial OS=Arabidopsis thaliana GN=STR19 PE=2 SV=1 Back     alignment and function description
>sp|F4IPI4|STR17_ARATH Rhodanese-like domain-containing protein 17 OS=Arabidopsis thaliana GN=STR17 PE=2 SV=1 Back     alignment and function description
>sp|Q94A65|STR14_ARATH Rhodanese-like domain-containing protein 14, chloroplastic OS=Arabidopsis thaliana GN=At4g27700 PE=2 SV=1 Back     alignment and function description
>sp|Q7MQ91|GLPE_VIBVY Thiosulfate sulfurtransferase GlpE OS=Vibrio vulnificus (strain YJ016) GN=glpE PE=3 SV=1 Back     alignment and function description
>sp|Q8DD53|GLPE_VIBVU Thiosulfate sulfurtransferase GlpE OS=Vibrio vulnificus (strain CMCP6) GN=glpE PE=3 SV=1 Back     alignment and function description
>sp|A4VHH7|GLPE_PSEU5 Thiosulfate sulfurtransferase GlpE OS=Pseudomonas stutzeri (strain A1501) GN=glpE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
224133954180 predicted protein [Populus trichocarpa] 0.967 0.983 0.695 3e-63
255579783182 Senescence-associated protein DIN1, puta 0.978 0.983 0.695 9e-62
351728052186 uncharacterized protein LOC100305968 [Gl 0.732 0.720 0.740 7e-52
357483967185 Senescence-associated protein DIN1 [Medi 0.732 0.724 0.742 2e-51
351726216185 uncharacterized protein LOC100499831 [Gl 0.732 0.724 0.740 5e-51
359497218177 PREDICTED: senescence-associated protein 0.814 0.841 0.670 6e-51
388501622179 unknown [Lotus japonicus] 0.732 0.748 0.720 2e-50
449434108184 PREDICTED: rhodanese-like domain-contain 0.879 0.875 0.620 3e-46
7340289150 OP1 [Cucumis sativus] 0.803 0.98 0.648 2e-45
147782977176 hypothetical protein VITISV_010789 [Viti 0.786 0.818 0.632 2e-45
>gi|224133954|ref|XP_002327720.1| predicted protein [Populus trichocarpa] gi|222836805|gb|EEE75198.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 128/184 (69%), Positives = 147/184 (79%), Gaps = 7/184 (3%)

Query: 1   MEATSLISLSSFAAGASSLPPVLCPHG-NNRRGLLSLTVDQQRCDNIGFISSKILSFCPK 59
           M A +++   S +  +++L PVLCP   N RRG+ +  V+ +RC +I  I+ K LSF PK
Sbjct: 1   MAAKAVVCYGS-STSSTTLRPVLCPQQLNKRRGVFA--VNSRRC-SIN-INHKSLSFRPK 55

Query: 60  ASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSG 119
            SLR NLEA G+PTSVPVRVAHEL QAGHRYLDVRTP+EFS GHA GAIN+PYMYRVGSG
Sbjct: 56  TSLRWNLEATGIPTSVPVRVAHELHQAGHRYLDVRTPDEFSTGHAAGAINIPYMYRVGSG 115

Query: 120 MTKNLKFVEEVSTRFRKHDEII-GCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNG 178
           MTKN KFVEEVS+ FRKHDEII GCQ GKRSMMAATDLL AGF  +TDIAGGFAAW QNG
Sbjct: 116 MTKNPKFVEEVSSHFRKHDEIIVGCQLGKRSMMAATDLLAAGFTAVTDIAGGFAAWTQNG 175

Query: 179 LPTE 182
           LPT+
Sbjct: 176 LPTD 179




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255579783|ref|XP_002530729.1| Senescence-associated protein DIN1, putative [Ricinus communis] gi|223529693|gb|EEF31635.1| Senescence-associated protein DIN1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351728052|ref|NP_001235646.1| uncharacterized protein LOC100305968 [Glycine max] gi|255627141|gb|ACU13915.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357483967|ref|XP_003612270.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|217071246|gb|ACJ83983.1| unknown [Medicago truncatula] gi|355513605|gb|AES95228.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|388495624|gb|AFK35878.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|351726216|ref|NP_001236607.1| uncharacterized protein LOC100499831 [Glycine max] gi|255626991|gb|ACU13840.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359497218|ref|XP_002271073.2| PREDICTED: senescence-associated protein DIN1-like [Vitis vinifera] gi|296088206|emb|CBI35721.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388501622|gb|AFK38877.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449434108|ref|XP_004134838.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] gi|449491287|ref|XP_004158850.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|7340289|gb|AAF61174.1|AF245222_1 OP1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147782977|emb|CAN72959.1| hypothetical protein VITISV_010789 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
TAIR|locus:2128038182 SEN1 "AT4G35770" [Arabidopsis 0.655 0.659 0.715 1.9e-42
UNIPROTKB|B2C7Y6185 NRIP1 "Chloroplast N receptor- 0.770 0.762 0.643 2.5e-42
TAIR|locus:2156937120 STR16 "AT5G66040" [Arabidopsis 0.612 0.933 0.681 8e-37
TAIR|locus:2156882138 STR18 "AT5G66170" [Arabidopsis 0.650 0.862 0.424 6.3e-21
TAIR|locus:505006261169 AT2G21045 [Arabidopsis thalian 0.573 0.621 0.396 3.6e-18
TAIR|locus:2827795156 AT2G17850 "AT2G17850" [Arabido 0.759 0.891 0.326 3.3e-15
UNIPROTKB|Q607E4120 MCA1816 "Sulfurtransferase" [M 0.437 0.666 0.446 1.3e-11
UNIPROTKB|Q3Z6P8144 DET1392 "Sulfurtransferase" [D 0.448 0.569 0.380 2.5e-10
TIGR_CMR|DET_1392144 DET_1392 "rhodanese-like domai 0.448 0.569 0.380 2.5e-10
UNIPROTKB|Q8ECN1132 SO_3105 "Periplasmic rhodanese 0.519 0.719 0.333 3.3e-08
TAIR|locus:2128038 SEN1 "AT4G35770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 449 (163.1 bits), Expect = 1.9e-42, P = 1.9e-42
 Identities = 88/123 (71%), Positives = 100/123 (81%)

Query:    63 RGNL--EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGM 120
             RGN+  EAV +PTSVPVRVA EL QAG+RYLDVRTP+EFS GH T AINVPYMYRVGSGM
Sbjct:    59 RGNVAAEAVKIPTSVPVRVARELAQAGYRYLDVRTPDEFSIGHPTRAINVPYMYRVGSGM 118

Query:   121 TKNLKFVEEVSTRFRKHDEII-GCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGL 179
              KN  F+ +VS+ FRKHDEII GC+SG+ S MA+TDLL AGF  ITDIAGG+ AW +N L
Sbjct:   119 VKNPSFLRQVSSHFRKHDEIIIGCESGQMSFMASTDLLTAGFTAITDIAGGYVAWTENEL 178

Query:   180 PTE 182
             P E
Sbjct:   179 PVE 181




GO:0003674 "molecular_function" evidence=ND
GO:0007568 "aging" evidence=IEP;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0006979 "response to oxidative stress" evidence=IEP
GO:0009611 "response to wounding" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
UNIPROTKB|B2C7Y6 NRIP1 "Chloroplast N receptor-interacting protein 1" [Nicotiana benthamiana (taxid:4100)] Back     alignment and assigned GO terms
TAIR|locus:2156937 STR16 "AT5G66040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156882 STR18 "AT5G66170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827795 AT2G17850 "AT2G17850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q607E4 MCA1816 "Sulfurtransferase" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q3Z6P8 DET1392 "Sulfurtransferase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1392 DET_1392 "rhodanese-like domain protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ECN1 SO_3105 "Periplasmic rhodanese domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q38853STR15_ARATHNo assigned EC number0.53920.93980.9450yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.10.914
3rd Layer2.8.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
PLN02160136 PLN02160, PLN02160, thiosulfate sulfurtransferase 3e-26
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 3e-19
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 1e-17
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 2e-16
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 7e-16
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 8e-16
cd01522117 cd01522, RHOD_1, Member of the Rhodanese Homology 6e-11
cd0152490 cd01524, RHOD_Pyr_redox, Member of the Rhodanese H 1e-08
cd01528101 cd01528, RHOD_2, Member of the Rhodanese Homology 1e-08
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 3e-08
cd0152799 cd01527, RHOD_YgaP, Member of the Rhodanese Homolo 9e-08
PRK00162108 PRK00162, glpE, thiosulfate sulfurtransferase; Val 1e-07
cd01526122 cd01526, RHOD_ThiF, Member of the Rhodanese Homolo 2e-07
cd01519106 cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom 3e-07
cd0152996 cd01529, 4RHOD_Repeats, Member of the Rhodanese Ho 5e-07
PRK07411390 PRK07411, PRK07411, hypothetical protein; Validate 1e-06
PRK10287104 PRK10287, PRK10287, thiosulfate:cyanide sulfurtran 2e-06
TIGR02981101 TIGR02981, phageshock_pspE, phage shock operon rho 9e-06
cd01447103 cd01447, Polysulfide_ST, Polysulfide-sulfurtransfe 3e-05
cd0144496 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and 5e-05
PRK11784 345 PRK11784, PRK11784, tRNA 2-selenouridine synthase; 2e-04
COG2897285 COG2897, SseA, Rhodanese-related sulfurtransferase 3e-04
cd01449118 cd01449, TST_Repeat_2, Thiosulfate sulfurtransfera 4e-04
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 7e-04
cd0153495 cd01534, 4RHOD_Repeat_3, Member of the Rhodanese H 0.001
cd01520128 cd01520, RHOD_YbbB, Member of the Rhodanese Homolo 0.001
TIGR03167 311 TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine s 0.002
>gnl|CDD|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase Back     alignment and domain information
 Score = 97.1 bits (241), Expect = 3e-26
 Identities = 50/111 (45%), Positives = 69/111 (62%), Gaps = 3/111 (2%)

Query: 74  SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGA--INVPYMYRVGSGMTKNLKFVEEVS 131
           SV V  A  LLQ+GH+YLDVRT +EF  GH   A  +N+PYM     G  KN +F+E+VS
Sbjct: 16  SVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVS 75

Query: 132 TRFRKHDEI-IGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT 181
           +     D+I +GCQSG RS+ A T+L+ AG+  + +  GG+ AW  +  P 
Sbjct: 76  SLLNPADDILVGCQSGARSLKATTELVAAGYKKVRNKGGGYLAWVDHSFPI 126


Length = 136

>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|178908 PRK00162, glpE, thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238787 cd01529, 4RHOD_Repeats, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|182356 PRK10287, PRK10287, thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>gnl|CDD|132026 TIGR02981, phageshock_pspE, phage shock operon rhodanese PspE Back     alignment and domain information
>gnl|CDD|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238721 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|236982 PRK11784, PRK11784, tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>gnl|CDD|225450 COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238726 cd01449, TST_Repeat_2, Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|238792 cd01534, 4RHOD_Repeat_3, Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>gnl|CDD|238778 cd01520, RHOD_YbbB, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|234132 TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
PLN02160136 thiosulfate sulfurtransferase 99.93
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.92
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.91
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.91
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.9
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.9
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.88
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.88
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.88
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.88
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.88
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.87
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.87
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.87
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.87
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.87
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.87
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.87
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.86
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.86
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.86
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.86
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.86
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.86
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.85
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.85
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.85
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.85
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.84
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.84
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.84
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.83
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.83
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.82
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.82
PRK01415247 hypothetical protein; Validated 99.81
PRK07411390 hypothetical protein; Validated 99.81
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.81
PRK05320257 rhodanese superfamily protein; Provisional 99.81
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.81
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.8
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.8
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.8
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.79
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.79
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.78
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.76
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.74
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.73
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.73
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.73
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.69
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.67
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.54
COG1054308 Predicted sulfurtransferase [General function pred 99.5
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.49
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 99.35
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 99.33
KOG1529 286 consensus Mercaptopyruvate sulfurtransferase/thios 99.3
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 98.64
COG2603 334 Predicted ATPase [General function prediction only 97.44
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 96.8
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 96.7
KOG1093725 consensus Predicted protein kinase (contains TBC a 95.72
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 95.65
KOG3636 669 consensus Uncharacterized conserved protein, conta 94.6
COG3453130 Uncharacterized protein conserved in bacteria [Fun 93.97
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 93.35
KOG1717 343 consensus Dual specificity phosphatase [Defense me 92.38
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 90.66
PLN02727 986 NAD kinase 88.99
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 88.52
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 87.65
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 82.5
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
Probab=99.93  E-value=7.7e-25  Score=158.57  Aligned_cols=112  Identities=45%  Similarity=0.816  Sum_probs=94.5

Q ss_pred             CccccHHHHHHHHhCCCEEEEcCCHHhHhcCCCCCc--EEeccccccCCCCCCCHHHHHHHhhcCCCCCeEE-EeCCChH
Q 030091           72 PTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGA--INVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEII-GCQSGKR  148 (183)
Q Consensus        72 ~~~i~~~~~~~~~~~~~~lIDvR~~~e~~~ghIpgA--i~ip~~~~~~~~~~~~~~~~~~~~~~i~~~~~iv-~C~~g~~  148 (183)
                      ...++++++.++++++.+|||||++.||..||||||  +|+|+......+.+...++...+...++++++|| ||.+|.|
T Consensus        14 ~~~i~~~e~~~~~~~~~~lIDVR~~~E~~~ghIpgA~~iniP~~~~~~~~~l~~~~~~~~~~~~~~~~~~IivyC~sG~R   93 (136)
T PLN02160         14 VVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVSSLLNPADDILVGCQSGAR   93 (136)
T ss_pred             eeEeCHHHHHHHHhCCCEEEECCCHHHHhcCCCCCcceecccchhcCcccccCCHHHHHHHHhccCCCCcEEEECCCcHH
Confidence            456889999999887788999999999999999999  8999843333344445566555555567888999 9999999


Q ss_pred             HHHHHHHHHHcCCCCeeEecccHHHHHhCCCCCCC
Q 030091          149 SMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP  183 (183)
Q Consensus       149 s~~aa~~L~~~G~~~v~~l~GG~~~W~~~g~pv~~  183 (183)
                      |..++..|...||++|++|.||+.+|.++|+|+++
T Consensus        94 S~~Aa~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~  128 (136)
T PLN02160         94 SLKATTELVAAGYKKVRNKGGGYLAWVDHSFPINQ  128 (136)
T ss_pred             HHHHHHHHHHcCCCCeeecCCcHHHHhhCCCCccc
Confidence            99999999999999999999999999999999863



>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only] Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1tq1_A129 Solution Structure Of At5g66040, A Putative Protein 2e-40
3tp9_A474 Crystal Structure Of Alicyclobacillus Acidocaldariu 7e-07
2kl3_A132 Solution Nmr Structure Of The Rhodanese-Like Domain 1e-05
3ilm_A141 Crystal Structure Of The Alr3790 Protein From Anaba 4e-05
3k9r_A115 X-Ray Structure Of The Rhodanese-Like Domain Of The 5e-05
3hix_A106 Crystal Structure Of The Rhodanese_3 Like Domain Fr 5e-05
1gn0_A108 Escherichia Coli Glpe Sulfurtransferase Soaked With 1e-04
3gk5_A108 Crystal Structure Of Rhodanese-Related Protein (Tvg 2e-04
3r2u_A466 2.1 Angstrom Resolution Crystal Structure Of Metall 5e-04
>pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 Back     alignment and structure

Iteration: 1

Score = 161 bits (408), Expect = 2e-40, Method: Compositional matrix adjust. Identities = 77/113 (68%), Positives = 91/113 (80%), Gaps = 1/113 (0%) Query: 71 VPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEV 130 VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R SGM+KN F+E+V Sbjct: 16 VPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQV 75 Query: 131 STRFRKHDEII-GCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 182 S+ F + D II GCQSG RS+ A TDLL+AGF G+ DI GG++AW +NGLPT+ Sbjct: 76 SSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 128
>pdb|3TP9|A Chain A, Crystal Structure Of Alicyclobacillus Acidocaldarius Protein With Beta-Lactamase And Rhodanese Domains Length = 474 Back     alignment and structure
>pdb|2KL3|A Chain A, Solution Nmr Structure Of The Rhodanese-Like Domain From Anabaena Sp Alr3790 Protein. Northeast Structural Genomics Consortium Target Nsr437a Length = 132 Back     alignment and structure
>pdb|3ILM|A Chain A, Crystal Structure Of The Alr3790 Protein From Anabaena Sp. Northeast Structural Genomics Consortium Target Nsr437h Length = 141 Back     alignment and structure
>pdb|3K9R|A Chain A, X-Ray Structure Of The Rhodanese-Like Domain Of The Alr3790 Protein From Anabaena Sp. Northeast Structural Genomics Consortium Target Nsr437c. Length = 115 Back     alignment and structure
>pdb|3HIX|A Chain A, Crystal Structure Of The Rhodanese_3 Like Domain From Anabaena Sp Alr3790 Protein. Northeast Structural Genomics Consortium Target Nsr437i Length = 106 Back     alignment and structure
>pdb|1GN0|A Chain A, Escherichia Coli Glpe Sulfurtransferase Soaked With Kcn Length = 108 Back     alignment and structure
>pdb|3GK5|A Chain A, Crystal Structure Of Rhodanese-Related Protein (Tvg0868615) From Thermoplasma Volcanium, Northeast Structural Genomics Consortium Target Tvr109a Length = 108 Back     alignment and structure
>pdb|3R2U|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp. Aureus Col Length = 466 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1tq1_A129 AT5G66040, senescence-associated family protein; C 4e-46
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 2e-26
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 7e-26
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 4e-22
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 4e-21
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 6e-21
1vee_A134 Proline-rich protein family; hypothetical protein, 1e-19
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 1e-19
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 2e-19
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 3e-19
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 3e-19
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 6e-19
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 3e-05
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 1e-18
3foj_A100 Uncharacterized protein; protein SSP1007, structur 1e-18
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 2e-18
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 7e-18
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 9e-18
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-14
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 3e-10
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-07
2jtq_A85 Phage shock protein E; solution structure rhodanes 7e-17
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 7e-17
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 1e-15
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 2e-15
3r2u_A466 Metallo-beta-lactamase family protein; structural 4e-15
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 1e-13
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 4e-11
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 1e-10
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 2e-10
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 3e-09
3op3_A216 M-phase inducer phosphatase 3; structural genomics 4e-08
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 4e-08
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 5e-08
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 7e-08
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 3e-05
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 6e-05
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 6e-05
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 9e-04
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
 Score =  147 bits (372), Expect = 4e-46
 Identities = 78/117 (66%), Positives = 92/117 (78%), Gaps = 1/117 (0%)

Query: 67  EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKF 126
           E   VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R  SGM+KN  F
Sbjct: 12  EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDF 71

Query: 127 VEEVSTRFRKHDEII-GCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 182
           +E+VS+ F + D II GCQSG RS+ A TDLL+AGF G+ DI GG++AW +NGLPT+
Sbjct: 72  LEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 128


>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Length = 271 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Length = 153 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Length = 230 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.95
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.95
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.94
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.94
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.94
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.94
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.93
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.93
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.93
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.93
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.92
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.92
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.91
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.91
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.91
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.91
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.9
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.9
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.9
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.9
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.9
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.89
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.89
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.89
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.89
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.88
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.88
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.87
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.87
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.87
1vee_A134 Proline-rich protein family; hypothetical protein, 99.87
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.87
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.87
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.86
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.86
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.86
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.86
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.86
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.85
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.85
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.85
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.85
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.84
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.84
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.84
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.83
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.83
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.83
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.83
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.82
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.82
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.8
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.79
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.79
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.78
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.78
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.77
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 99.74
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.72
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.72
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.71
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.7
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.69
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.39
2f46_A156 Hypothetical protein; structural genomics, joint c 97.9
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 93.93
1v8c_A168 MOAD related protein; riken structural genomics/pr 93.66
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 91.7
1xri_A151 AT1G05000; structural genomics, protein structure 88.11
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 86.48
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 86.15
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 85.79
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 85.62
2hcm_A164 Dual specificity protein phosphatase; structural g 84.33
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 84.21
1ywf_A 296 Phosphotyrosine protein phosphatase PTPB; four str 81.78
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 80.79
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
Probab=99.95  E-value=3.5e-28  Score=173.50  Aligned_cols=116  Identities=66%  Similarity=1.101  Sum_probs=101.5

Q ss_pred             cCCCCccccHHHHHHHHhCCCEEEEcCCHHhHhcCCCCCcEEeccccccCCCCCCCHHHHHHHhhcCCCCCeEE-EeCCC
Q 030091           68 AVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEII-GCQSG  146 (183)
Q Consensus        68 ~~~~~~~i~~~~~~~~~~~~~~lIDvR~~~e~~~ghIpgAi~ip~~~~~~~~~~~~~~~~~~~~~~i~~~~~iv-~C~~g  146 (183)
                      .......|+++++.++++++++|||||++.||..||||||+|||+......+.+...+++......++++++|| ||.+|
T Consensus        13 ~~~~~~~is~~e~~~~l~~~~~lIDvR~~~e~~~ghIpgAinip~~~~~~~~~~~~~~~~~~~~~~l~~~~~ivvyC~~G   92 (129)
T 1tq1_A           13 ESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSG   92 (129)
T ss_dssp             CSCCCEEEEHHHHHHHHHHTCCEEEESCHHHHHHCCBTTBEECCSCCCSTTTCCCTTTHHHHHTTTCCTTSSEEEEESSC
T ss_pred             hcCCCcccCHHHHHHHhcCCCEEEECCCHHHHhcCCCCCcEECcHhhcccccccCCHHHHHHHHhhCCCCCeEEEECCCC
Confidence            34455689999999998877899999999999999999999999965554555556677777777788999999 99999


Q ss_pred             hHHHHHHHHHHHcCCCCeeEecccHHHHHhCCCCCCC
Q 030091          147 KRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP  183 (183)
Q Consensus       147 ~~s~~aa~~L~~~G~~~v~~l~GG~~~W~~~g~pv~~  183 (183)
                      .||..+++.|++.||+||++|+||+.+|..+|+|+++
T Consensus        93 ~rs~~aa~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~  129 (129)
T 1tq1_A           93 GRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTKA  129 (129)
T ss_dssp             SHHHHHHHHHHHHHCCSEEEEECCHHHHHHHTCCCC-
T ss_pred             cHHHHHHHHHHHcCCCCeEEeCCcHHHHHhCCCCCCC
Confidence            9999999999999999999999999999999999874



>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 2e-32
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 2e-14
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 1e-10
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 1e-10
d1uara1143 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther 2e-09
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 2e-09
d1e0ca2136 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte 8e-09
d1e0ca1135 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter 3e-08
d1yt8a3157 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase 1e-07
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 2e-07
d1yt8a2101 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P 3e-07
d1ymka1174 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) 9e-07
d1okga2139 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtran 1e-06
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 6e-06
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 7e-06
d1okga1156 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransf 2e-05
d1urha2120 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtran 3e-05
d1urha1147 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransf 3e-04
d1rhsa1149 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [Ta 5e-04
d1rhsa2144 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [ 0.001
d1uara2141 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus th 0.002
d1t3ka_132 c.46.1.1 (A:) Dual specificity phosphatase Cdc25 { 0.003
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score =  111 bits (277), Expect = 2e-32
 Identities = 77/117 (65%), Positives = 91/117 (77%), Gaps = 1/117 (0%)

Query: 67  EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKF 126
           E   VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R  SGM+KN  F
Sbjct: 2   EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDF 61

Query: 127 VEEVSTRFRKHDEIIG-CQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 182
           +E+VS+ F + D II  CQSG RS+ A TDLL+AGF G+ DI GG++AW +NGLPT+
Sbjct: 62  LEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 118


>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 156 Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 147 Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 149 Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 144 Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 141 Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.96
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.93
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.93
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.93
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.92
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.91
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.9
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.9
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.9
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.9
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.9
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.88
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.88
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.86
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.86
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.85
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.7
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.64
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 88.43
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 85.59
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 84.24
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 83.01
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 81.08
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 80.77
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.96  E-value=1.7e-29  Score=176.37  Aligned_cols=114  Identities=68%  Similarity=1.120  Sum_probs=103.5

Q ss_pred             CCCCccccHHHHHHHHhCCCEEEEcCCHHhHhcCCCCCcEEeccccccCCCCCCCHHHHHHHhhcCCCCCeEE-EeCCCh
Q 030091           69 VGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEII-GCQSGK  147 (183)
Q Consensus        69 ~~~~~~i~~~~~~~~~~~~~~lIDvR~~~e~~~ghIpgAi~ip~~~~~~~~~~~~~~~~~~~~~~i~~~~~iv-~C~~g~  147 (183)
                      ...+..+++.++.++++++.+|||||++.||..||||||+|+|+............+++......++++++|| ||++|.
T Consensus         4 ~~~p~~i~~~~a~~l~~~g~~liDvR~~~e~~~ghi~ga~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~iv~~C~~G~   83 (119)
T d1tq1a_           4 SRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGG   83 (119)
T ss_dssp             SCCCEEEEHHHHHHHHHHTCCEEEESCHHHHHHCCBTTBEECCSCCCSTTTCCCTTTHHHHHTTTCCTTSSEEEEESSCS
T ss_pred             ccCCCccCHHHHHHHHHCcCEEEECCCHHHHHcCCCCCccchhhcccccccccccHHHHHHHHHhcCCCcEEEEEcCCcC
Confidence            3456789999999999989999999999999999999999999876655666677788888888899999999 999999


Q ss_pred             HHHHHHHHHHHcCCCCeeEecccHHHHHhCCCCCC
Q 030091          148 RSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE  182 (183)
Q Consensus       148 ~s~~aa~~L~~~G~~~v~~l~GG~~~W~~~g~pv~  182 (183)
                      ||..++..|.+.||+||++|+||+.+|.++|+|++
T Consensus        84 rs~~a~~~L~~~G~~nv~~l~GG~~~W~~~g~P~e  118 (119)
T d1tq1a_          84 RSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK  118 (119)
T ss_dssp             HHHHHHHHHHHHHCCSEEEEECCHHHHHHHTCCCC
T ss_pred             cHHHHHHHHHhcccCCeEEecChHHHHHHCCCCcc
Confidence            99999999999999999999999999999999997



>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure