Citrus Sinensis ID: 030091
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| 224133954 | 180 | predicted protein [Populus trichocarpa] | 0.967 | 0.983 | 0.695 | 3e-63 | |
| 255579783 | 182 | Senescence-associated protein DIN1, puta | 0.978 | 0.983 | 0.695 | 9e-62 | |
| 351728052 | 186 | uncharacterized protein LOC100305968 [Gl | 0.732 | 0.720 | 0.740 | 7e-52 | |
| 357483967 | 185 | Senescence-associated protein DIN1 [Medi | 0.732 | 0.724 | 0.742 | 2e-51 | |
| 351726216 | 185 | uncharacterized protein LOC100499831 [Gl | 0.732 | 0.724 | 0.740 | 5e-51 | |
| 359497218 | 177 | PREDICTED: senescence-associated protein | 0.814 | 0.841 | 0.670 | 6e-51 | |
| 388501622 | 179 | unknown [Lotus japonicus] | 0.732 | 0.748 | 0.720 | 2e-50 | |
| 449434108 | 184 | PREDICTED: rhodanese-like domain-contain | 0.879 | 0.875 | 0.620 | 3e-46 | |
| 7340289 | 150 | OP1 [Cucumis sativus] | 0.803 | 0.98 | 0.648 | 2e-45 | |
| 147782977 | 176 | hypothetical protein VITISV_010789 [Viti | 0.786 | 0.818 | 0.632 | 2e-45 |
| >gi|224133954|ref|XP_002327720.1| predicted protein [Populus trichocarpa] gi|222836805|gb|EEE75198.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 246 bits (628), Expect = 3e-63, Method: Compositional matrix adjust.
Identities = 128/184 (69%), Positives = 147/184 (79%), Gaps = 7/184 (3%)
Query: 1 MEATSLISLSSFAAGASSLPPVLCPHG-NNRRGLLSLTVDQQRCDNIGFISSKILSFCPK 59
M A +++ S + +++L PVLCP N RRG+ + V+ +RC +I I+ K LSF PK
Sbjct: 1 MAAKAVVCYGS-STSSTTLRPVLCPQQLNKRRGVFA--VNSRRC-SIN-INHKSLSFRPK 55
Query: 60 ASLRGNLEAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSG 119
SLR NLEA G+PTSVPVRVAHEL QAGHRYLDVRTP+EFS GHA GAIN+PYMYRVGSG
Sbjct: 56 TSLRWNLEATGIPTSVPVRVAHELHQAGHRYLDVRTPDEFSTGHAAGAINIPYMYRVGSG 115
Query: 120 MTKNLKFVEEVSTRFRKHDEII-GCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNG 178
MTKN KFVEEVS+ FRKHDEII GCQ GKRSMMAATDLL AGF +TDIAGGFAAW QNG
Sbjct: 116 MTKNPKFVEEVSSHFRKHDEIIVGCQLGKRSMMAATDLLAAGFTAVTDIAGGFAAWTQNG 175
Query: 179 LPTE 182
LPT+
Sbjct: 176 LPTD 179
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255579783|ref|XP_002530729.1| Senescence-associated protein DIN1, putative [Ricinus communis] gi|223529693|gb|EEF31635.1| Senescence-associated protein DIN1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|351728052|ref|NP_001235646.1| uncharacterized protein LOC100305968 [Glycine max] gi|255627141|gb|ACU13915.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357483967|ref|XP_003612270.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|217071246|gb|ACJ83983.1| unknown [Medicago truncatula] gi|355513605|gb|AES95228.1| Senescence-associated protein DIN1 [Medicago truncatula] gi|388495624|gb|AFK35878.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|351726216|ref|NP_001236607.1| uncharacterized protein LOC100499831 [Glycine max] gi|255626991|gb|ACU13840.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359497218|ref|XP_002271073.2| PREDICTED: senescence-associated protein DIN1-like [Vitis vinifera] gi|296088206|emb|CBI35721.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388501622|gb|AFK38877.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449434108|ref|XP_004134838.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] gi|449491287|ref|XP_004158850.1| PREDICTED: rhodanese-like domain-containing protein 15, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|7340289|gb|AAF61174.1|AF245222_1 OP1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|147782977|emb|CAN72959.1| hypothetical protein VITISV_010789 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| TAIR|locus:2128038 | 182 | SEN1 "AT4G35770" [Arabidopsis | 0.655 | 0.659 | 0.715 | 1.9e-42 | |
| UNIPROTKB|B2C7Y6 | 185 | NRIP1 "Chloroplast N receptor- | 0.770 | 0.762 | 0.643 | 2.5e-42 | |
| TAIR|locus:2156937 | 120 | STR16 "AT5G66040" [Arabidopsis | 0.612 | 0.933 | 0.681 | 8e-37 | |
| TAIR|locus:2156882 | 138 | STR18 "AT5G66170" [Arabidopsis | 0.650 | 0.862 | 0.424 | 6.3e-21 | |
| TAIR|locus:505006261 | 169 | AT2G21045 [Arabidopsis thalian | 0.573 | 0.621 | 0.396 | 3.6e-18 | |
| TAIR|locus:2827795 | 156 | AT2G17850 "AT2G17850" [Arabido | 0.759 | 0.891 | 0.326 | 3.3e-15 | |
| UNIPROTKB|Q607E4 | 120 | MCA1816 "Sulfurtransferase" [M | 0.437 | 0.666 | 0.446 | 1.3e-11 | |
| UNIPROTKB|Q3Z6P8 | 144 | DET1392 "Sulfurtransferase" [D | 0.448 | 0.569 | 0.380 | 2.5e-10 | |
| TIGR_CMR|DET_1392 | 144 | DET_1392 "rhodanese-like domai | 0.448 | 0.569 | 0.380 | 2.5e-10 | |
| UNIPROTKB|Q8ECN1 | 132 | SO_3105 "Periplasmic rhodanese | 0.519 | 0.719 | 0.333 | 3.3e-08 |
| TAIR|locus:2128038 SEN1 "AT4G35770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 449 (163.1 bits), Expect = 1.9e-42, P = 1.9e-42
Identities = 88/123 (71%), Positives = 100/123 (81%)
Query: 63 RGNL--EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGM 120
RGN+ EAV +PTSVPVRVA EL QAG+RYLDVRTP+EFS GH T AINVPYMYRVGSGM
Sbjct: 59 RGNVAAEAVKIPTSVPVRVARELAQAGYRYLDVRTPDEFSIGHPTRAINVPYMYRVGSGM 118
Query: 121 TKNLKFVEEVSTRFRKHDEII-GCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGL 179
KN F+ +VS+ FRKHDEII GC+SG+ S MA+TDLL AGF ITDIAGG+ AW +N L
Sbjct: 119 VKNPSFLRQVSSHFRKHDEIIIGCESGQMSFMASTDLLTAGFTAITDIAGGYVAWTENEL 178
Query: 180 PTE 182
P E
Sbjct: 179 PVE 181
|
|
| UNIPROTKB|B2C7Y6 NRIP1 "Chloroplast N receptor-interacting protein 1" [Nicotiana benthamiana (taxid:4100)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156937 STR16 "AT5G66040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156882 STR18 "AT5G66170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827795 AT2G17850 "AT2G17850" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q607E4 MCA1816 "Sulfurtransferase" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3Z6P8 DET1392 "Sulfurtransferase" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1392 DET_1392 "rhodanese-like domain protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8ECN1 SO_3105 "Periplasmic rhodanese domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| PLN02160 | 136 | PLN02160, PLN02160, thiosulfate sulfurtransferase | 3e-26 | |
| smart00450 | 100 | smart00450, RHOD, Rhodanese Homology Domain | 3e-19 | |
| cd00158 | 89 | cd00158, RHOD, Rhodanese Homology Domain (RHOD); a | 1e-17 | |
| pfam00581 | 106 | pfam00581, Rhodanese, Rhodanese-like domain | 2e-16 | |
| COG0607 | 110 | COG0607, PspE, Rhodanese-related sulfurtransferase | 7e-16 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 8e-16 | |
| cd01522 | 117 | cd01522, RHOD_1, Member of the Rhodanese Homology | 6e-11 | |
| cd01524 | 90 | cd01524, RHOD_Pyr_redox, Member of the Rhodanese H | 1e-08 | |
| cd01528 | 101 | cd01528, RHOD_2, Member of the Rhodanese Homology | 1e-08 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 3e-08 | |
| cd01527 | 99 | cd01527, RHOD_YgaP, Member of the Rhodanese Homolo | 9e-08 | |
| PRK00162 | 108 | PRK00162, glpE, thiosulfate sulfurtransferase; Val | 1e-07 | |
| cd01526 | 122 | cd01526, RHOD_ThiF, Member of the Rhodanese Homolo | 2e-07 | |
| cd01519 | 106 | cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom | 3e-07 | |
| cd01529 | 96 | cd01529, 4RHOD_Repeats, Member of the Rhodanese Ho | 5e-07 | |
| PRK07411 | 390 | PRK07411, PRK07411, hypothetical protein; Validate | 1e-06 | |
| PRK10287 | 104 | PRK10287, PRK10287, thiosulfate:cyanide sulfurtran | 2e-06 | |
| TIGR02981 | 101 | TIGR02981, phageshock_pspE, phage shock operon rho | 9e-06 | |
| cd01447 | 103 | cd01447, Polysulfide_ST, Polysulfide-sulfurtransfe | 3e-05 | |
| cd01444 | 96 | cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and | 5e-05 | |
| PRK11784 | 345 | PRK11784, PRK11784, tRNA 2-selenouridine synthase; | 2e-04 | |
| COG2897 | 285 | COG2897, SseA, Rhodanese-related sulfurtransferase | 3e-04 | |
| cd01449 | 118 | cd01449, TST_Repeat_2, Thiosulfate sulfurtransfera | 4e-04 | |
| PRK07878 | 392 | PRK07878, PRK07878, molybdopterin biosynthesis-lik | 7e-04 | |
| cd01534 | 95 | cd01534, 4RHOD_Repeat_3, Member of the Rhodanese H | 0.001 | |
| cd01520 | 128 | cd01520, RHOD_YbbB, Member of the Rhodanese Homolo | 0.001 | |
| TIGR03167 | 311 | TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine s | 0.002 |
| >gnl|CDD|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
Score = 97.1 bits (241), Expect = 3e-26
Identities = 50/111 (45%), Positives = 69/111 (62%), Gaps = 3/111 (2%)
Query: 74 SVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGA--INVPYMYRVGSGMTKNLKFVEEVS 131
SV V A LLQ+GH+YLDVRT +EF GH A +N+PYM G KN +F+E+VS
Sbjct: 16 SVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVS 75
Query: 132 TRFRKHDEI-IGCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPT 181
+ D+I +GCQSG RS+ A T+L+ AG+ + + GG+ AW + P
Sbjct: 76 SLLNPADDILVGCQSGARSLKATTELVAAGYKKVRNKGGGYLAWVDHSFPI 126
|
Length = 136 |
| >gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|178908 PRK00162, glpE, thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238787 cd01529, 4RHOD_Repeats, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|182356 PRK10287, PRK10287, thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132026 TIGR02981, phageshock_pspE, phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >gnl|CDD|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|238721 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|236982 PRK11784, PRK11784, tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225450 COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238726 cd01449, TST_Repeat_2, Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238792 cd01534, 4RHOD_Repeat_3, Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >gnl|CDD|238778 cd01520, RHOD_YbbB, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|234132 TIGR03167, tRNA_sel_U_synt, tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| PLN02160 | 136 | thiosulfate sulfurtransferase | 99.93 | |
| KOG1530 | 136 | consensus Rhodanese-related sulfurtransferase [Ino | 99.92 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 99.91 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 99.91 | |
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 99.9 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 99.9 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 99.88 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 99.88 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 99.88 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 99.88 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 99.88 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 99.87 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 99.87 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 99.87 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 99.87 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.87 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 99.87 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 99.87 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 99.86 | |
| cd01535 | 145 | 4RHOD_Repeat_4 Member of the Rhodanese Homology Do | 99.86 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 99.86 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 99.86 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.86 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 99.86 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 99.85 | |
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 99.85 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.85 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 99.85 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 99.84 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 99.84 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.84 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.83 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 99.83 | |
| cd01445 | 138 | TST_Repeats Thiosulfate sulfurtransferases (TST) c | 99.82 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.82 | |
| PRK01415 | 247 | hypothetical protein; Validated | 99.81 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.81 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.81 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 99.81 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.81 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 99.8 | |
| cd00158 | 89 | RHOD Rhodanese Homology Domain (RHOD); an alpha be | 99.8 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 99.8 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 99.79 | |
| cd01531 | 113 | Acr2p Eukaryotic arsenate resistance proteins are | 99.79 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 99.78 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 99.76 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 99.74 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 99.73 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 99.73 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.73 | |
| cd01446 | 132 | DSP_MapKP N-terminal regulatory rhodanese domain o | 99.69 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 99.67 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.54 | |
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 99.5 | |
| PRK01269 | 482 | tRNA s(4)U8 sulfurtransferase; Provisional | 99.49 | |
| KOG3772 | 325 | consensus M-phase inducer phosphatase [Cell cycle | 99.35 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 99.33 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 99.3 | |
| COG5105 | 427 | MIH1 Mitotic inducer, protein phosphatase [Cell di | 98.64 | |
| COG2603 | 334 | Predicted ATPase [General function prediction only | 97.44 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 96.8 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 96.7 | |
| KOG1093 | 725 | consensus Predicted protein kinase (contains TBC a | 95.72 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 95.65 | |
| KOG3636 | 669 | consensus Uncharacterized conserved protein, conta | 94.6 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 93.97 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 93.35 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 92.38 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 90.66 | |
| PLN02727 | 986 | NAD kinase | 88.99 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 88.52 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 87.65 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 82.5 |
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
Probab=99.93 E-value=7.7e-25 Score=158.57 Aligned_cols=112 Identities=45% Similarity=0.816 Sum_probs=94.5
Q ss_pred CccccHHHHHHHHhCCCEEEEcCCHHhHhcCCCCCc--EEeccccccCCCCCCCHHHHHHHhhcCCCCCeEE-EeCCChH
Q 030091 72 PTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGA--INVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEII-GCQSGKR 148 (183)
Q Consensus 72 ~~~i~~~~~~~~~~~~~~lIDvR~~~e~~~ghIpgA--i~ip~~~~~~~~~~~~~~~~~~~~~~i~~~~~iv-~C~~g~~ 148 (183)
...++++++.++++++.+|||||++.||..|||||| +|+|+......+.+...++...+...++++++|| ||.+|.|
T Consensus 14 ~~~i~~~e~~~~~~~~~~lIDVR~~~E~~~ghIpgA~~iniP~~~~~~~~~l~~~~~~~~~~~~~~~~~~IivyC~sG~R 93 (136)
T PLN02160 14 VVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVSSLLNPADDILVGCQSGAR 93 (136)
T ss_pred eeEeCHHHHHHHHhCCCEEEECCCHHHHhcCCCCCcceecccchhcCcccccCCHHHHHHHHhccCCCCcEEEECCCcHH
Confidence 456889999999887788999999999999999999 8999843333344445566555555567888999 9999999
Q ss_pred HHHHHHHHHHcCCCCeeEecccHHHHHhCCCCCCC
Q 030091 149 SMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP 183 (183)
Q Consensus 149 s~~aa~~L~~~G~~~v~~l~GG~~~W~~~g~pv~~ 183 (183)
|..++..|...||++|++|.||+.+|.++|+|+++
T Consensus 94 S~~Aa~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~ 128 (136)
T PLN02160 94 SLKATTELVAAGYKKVRNKGGGYLAWVDHSFPINQ 128 (136)
T ss_pred HHHHHHHHHHcCCCCeeecCCcHHHHhhCCCCccc
Confidence 99999999999999999999999999999999863
|
|
| >KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG2603 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 183 | ||||
| 1tq1_A | 129 | Solution Structure Of At5g66040, A Putative Protein | 2e-40 | ||
| 3tp9_A | 474 | Crystal Structure Of Alicyclobacillus Acidocaldariu | 7e-07 | ||
| 2kl3_A | 132 | Solution Nmr Structure Of The Rhodanese-Like Domain | 1e-05 | ||
| 3ilm_A | 141 | Crystal Structure Of The Alr3790 Protein From Anaba | 4e-05 | ||
| 3k9r_A | 115 | X-Ray Structure Of The Rhodanese-Like Domain Of The | 5e-05 | ||
| 3hix_A | 106 | Crystal Structure Of The Rhodanese_3 Like Domain Fr | 5e-05 | ||
| 1gn0_A | 108 | Escherichia Coli Glpe Sulfurtransferase Soaked With | 1e-04 | ||
| 3gk5_A | 108 | Crystal Structure Of Rhodanese-Related Protein (Tvg | 2e-04 | ||
| 3r2u_A | 466 | 2.1 Angstrom Resolution Crystal Structure Of Metall | 5e-04 |
| >pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 | Back alignment and structure |
|
| >pdb|3TP9|A Chain A, Crystal Structure Of Alicyclobacillus Acidocaldarius Protein With Beta-Lactamase And Rhodanese Domains Length = 474 | Back alignment and structure |
| >pdb|2KL3|A Chain A, Solution Nmr Structure Of The Rhodanese-Like Domain From Anabaena Sp Alr3790 Protein. Northeast Structural Genomics Consortium Target Nsr437a Length = 132 | Back alignment and structure |
| >pdb|3ILM|A Chain A, Crystal Structure Of The Alr3790 Protein From Anabaena Sp. Northeast Structural Genomics Consortium Target Nsr437h Length = 141 | Back alignment and structure |
| >pdb|3K9R|A Chain A, X-Ray Structure Of The Rhodanese-Like Domain Of The Alr3790 Protein From Anabaena Sp. Northeast Structural Genomics Consortium Target Nsr437c. Length = 115 | Back alignment and structure |
| >pdb|3HIX|A Chain A, Crystal Structure Of The Rhodanese_3 Like Domain From Anabaena Sp Alr3790 Protein. Northeast Structural Genomics Consortium Target Nsr437i Length = 106 | Back alignment and structure |
| >pdb|1GN0|A Chain A, Escherichia Coli Glpe Sulfurtransferase Soaked With Kcn Length = 108 | Back alignment and structure |
| >pdb|3GK5|A Chain A, Crystal Structure Of Rhodanese-Related Protein (Tvg0868615) From Thermoplasma Volcanium, Northeast Structural Genomics Consortium Target Tvr109a Length = 108 | Back alignment and structure |
| >pdb|3R2U|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of Metallo-Beta-Lactamase From Staphylococcus Aureus Subsp. Aureus Col Length = 466 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 4e-46 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 2e-26 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 7e-26 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 4e-22 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 4e-21 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 6e-21 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 1e-19 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 1e-19 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 2e-19 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 3e-19 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 3e-19 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 6e-19 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 3e-05 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 1e-18 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 1e-18 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 2e-18 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 7e-18 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 9e-18 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 2e-14 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 3e-10 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 1e-07 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 7e-17 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 7e-17 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 1e-15 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 2e-15 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 4e-15 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 1e-13 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 4e-11 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 1e-10 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 2e-10 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 3e-09 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 4e-08 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 4e-08 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 5e-08 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 7e-08 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 3e-05 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 6e-05 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 6e-05 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 9e-04 |
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 | Back alignment and structure |
|---|
Score = 147 bits (372), Expect = 4e-46
Identities = 78/117 (66%), Positives = 92/117 (78%), Gaps = 1/117 (0%)
Query: 67 EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKF 126
E VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R SGM+KN F
Sbjct: 12 EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDF 71
Query: 127 VEEVSTRFRKHDEII-GCQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 182
+E+VS+ F + D II GCQSG RS+ A TDLL+AGF G+ DI GG++AW +NGLPT+
Sbjct: 72 LEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 128
|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Length = 271 | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Length = 153 | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Length = 230 | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 99.95 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.95 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 99.94 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 99.94 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.94 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 99.94 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 99.93 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 99.93 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 99.93 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 99.93 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 99.92 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 99.92 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 99.91 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 99.91 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.91 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.91 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.9 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 99.9 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.9 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.9 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.9 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 99.89 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.89 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 99.89 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.89 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 99.88 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 99.88 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 99.87 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.87 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.87 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 99.87 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.87 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.87 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 99.86 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 99.86 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.86 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 99.86 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.86 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.85 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.85 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 99.85 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.85 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.84 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 99.84 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 99.84 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 99.83 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.83 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.83 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 99.83 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.82 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.82 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 99.8 | |
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 99.79 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 99.79 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 99.78 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.78 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.77 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.74 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 99.72 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 99.72 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 99.71 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.7 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.69 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 99.39 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 97.9 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 93.93 | |
| 1v8c_A | 168 | MOAD related protein; riken structural genomics/pr | 93.66 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 91.7 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 88.11 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 86.48 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 86.15 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 85.79 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 85.62 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 84.33 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 84.21 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 81.78 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 80.79 |
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
Probab=99.95 E-value=3.5e-28 Score=173.50 Aligned_cols=116 Identities=66% Similarity=1.101 Sum_probs=101.5
Q ss_pred cCCCCccccHHHHHHHHhCCCEEEEcCCHHhHhcCCCCCcEEeccccccCCCCCCCHHHHHHHhhcCCCCCeEE-EeCCC
Q 030091 68 AVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEII-GCQSG 146 (183)
Q Consensus 68 ~~~~~~~i~~~~~~~~~~~~~~lIDvR~~~e~~~ghIpgAi~ip~~~~~~~~~~~~~~~~~~~~~~i~~~~~iv-~C~~g 146 (183)
.......|+++++.++++++++|||||++.||..||||||+|||+......+.+...+++......++++++|| ||.+|
T Consensus 13 ~~~~~~~is~~e~~~~l~~~~~lIDvR~~~e~~~ghIpgAinip~~~~~~~~~~~~~~~~~~~~~~l~~~~~ivvyC~~G 92 (129)
T 1tq1_A 13 ESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSG 92 (129)
T ss_dssp CSCCCEEEEHHHHHHHHHHTCCEEEESCHHHHHHCCBTTBEECCSCCCSTTTCCCTTTHHHHHTTTCCTTSSEEEEESSC
T ss_pred hcCCCcccCHHHHHHHhcCCCEEEECCCHHHHhcCCCCCcEECcHhhcccccccCCHHHHHHHHhhCCCCCeEEEECCCC
Confidence 34455689999999998877899999999999999999999999965554555556677777777788999999 99999
Q ss_pred hHHHHHHHHHHHcCCCCeeEecccHHHHHhCCCCCCC
Q 030091 147 KRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTEP 183 (183)
Q Consensus 147 ~~s~~aa~~L~~~G~~~v~~l~GG~~~W~~~g~pv~~ 183 (183)
.||..+++.|++.||+||++|+||+.+|..+|+|+++
T Consensus 93 ~rs~~aa~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~ 129 (129)
T 1tq1_A 93 GRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTKA 129 (129)
T ss_dssp SHHHHHHHHHHHHHCCSEEEEECCHHHHHHHTCCCC-
T ss_pred cHHHHHHHHHHHcCCCCeEEeCCcHHHHHhCCCCCCC
Confidence 9999999999999999999999999999999999874
|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 183 | ||||
| d1tq1a_ | 119 | c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc | 2e-32 | |
| d1gmxa_ | 108 | c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia | 2e-14 | |
| d1yt8a1 | 136 | c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase | 1e-10 | |
| d1qxna_ | 137 | c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf | 1e-10 | |
| d1uara1 | 143 | c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther | 2e-09 | |
| d1c25a_ | 161 | c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: | 2e-09 | |
| d1e0ca2 | 136 | c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte | 8e-09 | |
| d1e0ca1 | 135 | c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter | 3e-08 | |
| d1yt8a3 | 157 | c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase | 1e-07 | |
| d1hzma_ | 154 | c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat | 2e-07 | |
| d1yt8a2 | 101 | c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P | 3e-07 | |
| d1ymka1 | 174 | c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) | 9e-07 | |
| d1okga2 | 139 | c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtran | 1e-06 | |
| d1yt8a4 | 130 | c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase | 6e-06 | |
| d2gwfa1 | 135 | c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h | 7e-06 | |
| d1okga1 | 156 | c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransf | 2e-05 | |
| d1urha2 | 120 | c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtran | 3e-05 | |
| d1urha1 | 147 | c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransf | 3e-04 | |
| d1rhsa1 | 149 | c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [Ta | 5e-04 | |
| d1rhsa2 | 144 | c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [ | 0.001 | |
| d1uara2 | 141 | c.46.1.2 (A:145-285) Sulfurtransferase {Thermus th | 0.002 | |
| d1t3ka_ | 132 | c.46.1.1 (A:) Dual specificity phosphatase Cdc25 { | 0.003 |
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Single-domain sulfurtransferase domain: Thiosulfate sulfurtransferase/Senescence-associated protein species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 111 bits (277), Expect = 2e-32
Identities = 77/117 (65%), Positives = 91/117 (77%), Gaps = 1/117 (0%)
Query: 67 EAVGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKF 126
E VP+SV V VAH+LL AGHRYLDVRTPEEFS GHA GAINVPYM R SGM+KN F
Sbjct: 2 EESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDF 61
Query: 127 VEEVSTRFRKHDEIIG-CQSGKRSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 182
+E+VS+ F + D II CQSG RS+ A TDLL+AGF G+ DI GG++AW +NGLPT+
Sbjct: 62 LEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 118
|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 139 | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 156 | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 147 | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 149 | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 144 | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 141 | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 132 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 99.96 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 99.93 | |
| d1e0ca2 | 136 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.93 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.93 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.92 | |
| d1yt8a2 | 101 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.91 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 99.9 | |
| d1urha1 | 147 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.9 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.9 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.9 | |
| d1rhsa1 | 149 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.9 | |
| d1e0ca1 | 135 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.9 | |
| d1uara1 | 143 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.9 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.88 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.88 | |
| d1okga2 | 139 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.86 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 99.86 | |
| d1okga1 | 156 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.85 | |
| d1c25a_ | 161 | CDC25a {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1ymka1 | 174 | CDC25b {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d2gwfa1 | 135 | Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum | 99.7 | |
| d1hzma_ | 154 | Erk2 binding domain of Mapk phosphatase mkp-3 {Hum | 99.64 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 88.43 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 85.59 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 84.24 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 83.01 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 81.08 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 80.77 |
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Single-domain sulfurtransferase domain: Thiosulfate sulfurtransferase/Senescence-associated protein species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.96 E-value=1.7e-29 Score=176.37 Aligned_cols=114 Identities=68% Similarity=1.120 Sum_probs=103.5
Q ss_pred CCCCccccHHHHHHHHhCCCEEEEcCCHHhHhcCCCCCcEEeccccccCCCCCCCHHHHHHHhhcCCCCCeEE-EeCCCh
Q 030091 69 VGVPTSVPVRVAHELLQAGHRYLDVRTPEEFSAGHATGAINVPYMYRVGSGMTKNLKFVEEVSTRFRKHDEII-GCQSGK 147 (183)
Q Consensus 69 ~~~~~~i~~~~~~~~~~~~~~lIDvR~~~e~~~ghIpgAi~ip~~~~~~~~~~~~~~~~~~~~~~i~~~~~iv-~C~~g~ 147 (183)
...+..+++.++.++++++.+|||||++.||..||||||+|+|+............+++......++++++|| ||++|.
T Consensus 4 ~~~p~~i~~~~a~~l~~~g~~liDvR~~~e~~~ghi~ga~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~iv~~C~~G~ 83 (119)
T d1tq1a_ 4 SRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGG 83 (119)
T ss_dssp SCCCEEEEHHHHHHHHHHTCCEEEESCHHHHHHCCBTTBEECCSCCCSTTTCCCTTTHHHHHTTTCCTTSSEEEEESSCS
T ss_pred ccCCCccCHHHHHHHHHCcCEEEECCCHHHHHcCCCCCccchhhcccccccccccHHHHHHHHHhcCCCcEEEEEcCCcC
Confidence 3456789999999999989999999999999999999999999876655666677788888888899999999 999999
Q ss_pred HHHHHHHHHHHcCCCCeeEecccHHHHHhCCCCCC
Q 030091 148 RSMMAATDLLNAGFAGITDIAGGFAAWRQNGLPTE 182 (183)
Q Consensus 148 ~s~~aa~~L~~~G~~~v~~l~GG~~~W~~~g~pv~ 182 (183)
||..++..|.+.||+||++|+||+.+|.++|+|++
T Consensus 84 rs~~a~~~L~~~G~~nv~~l~GG~~~W~~~g~P~e 118 (119)
T d1tq1a_ 84 RSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 118 (119)
T ss_dssp HHHHHHHHHHHHHCCSEEEEECCHHHHHHHTCCCC
T ss_pred cHHHHHHHHHhcccCCeEEecChHHHHHHCCCCcc
Confidence 99999999999999999999999999999999997
|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|