Citrus Sinensis ID: 030112

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MIRLFKVKEKQKEDAENNTGGTPVKKQCARELRLHKDITELNLPEACKISFPNGQDDLMNFEVSIKPDEGYYQNGTFVFSFEVPPIYPHDAPKVKCKTKVYHPNIDLEGNVCLNVLREDWKPVLNINTIIYGLYHLFTEPNHEDPLNHDAAELLRDSPACFETNVRMALQGGYIGDEYFEPVM
ccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccCECcccccccEEEEEEECcccccccccEEEEEEEcccccccccccEEECccccccccccccccHHHHHcccccccccHHHHHHHHHHHHcccccccccccHHHHHHHccHHHHHHHHHHHHHccccccccccccc
MIRLF*************************ELRLHKDITELNLPEACKISFPNGQDDLMNFEVSIKPDEGYYQNGTFVFSFEVPPIYPHDAPKVKCKTKVYHPNIDLEGNVCLNVLREDWKPVLNINTIIYGLYHLFTEPNHEDPLNHDAAELLRDSPACFETNVRMALQGGYIGDEYFEPVM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRLFKVKEKQKEDAENNTGGTPVKKQCARELRLHKDITELNLPEACKISFPNGQDDLMNFEVSIKPDEGYYQNGTFVFSFEVPPIYPHDAPKVKCKTKVYHPNIDLEGNVCLNVLREDWKPVLNINTIIYGLYHLFTEPNHEDPLNHDAAELLRDSPACFETNVRMALQGGYIGDEYFEPVM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NEDD8-conjugating enzyme Ubc12 Accepts the ubiquitin-like protein NEDD8/RUB1 from the ECR1-AXR1 E1 complex and catalyzes its covalent attachment to other proteins.confidentQ9SDY5
NEDD8-conjugating enzyme Ubc12 Accepts the ubiquitin-like protein NEDD8 from the Uba3-Ula1 E1 complex and catalyzes its covalent attachment to other proteins.probableQ9VSF3
NEDD8-conjugating enzyme Ubc12 Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation.probableP61082

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NVU, chain C
Confidence level:very confident
Coverage over the Query: 3-183
View the alignment between query and template
View the model in PyMOL