Citrus Sinensis ID: 030113


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MGALVSKFWFMLFPGKDYKIIIVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEAWDVGGQERLRTSWATYYRGTHAVIVVIDSTDRARISIMKDELFRLLGHEDLQHSVVLIFANKQDLKDAMTPAEITDALSLHSIKNHDWHIQACSALTGDGLVDGLEWISQRVTGKAPS
cccHHHHHHHHcccccCEEEEEEEcccccHHHHHHHHccccCEEEccccccEEEEEEEccEEEEEEEEcccccccccHHHHcccccEEEEEEEcccccHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHccccccccccEEEEEccccccccHHHHHHHHHHHHHccccc
*GALVSKFWFMLFPGKDYKIIIVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEAWDVGGQERLRTSWATYYRGTHAVIVVIDSTDRARISIMKDELFRLLGHEDLQHSVVLIFANKQDLKDAMTPAEITDALSLHSIKNHDWHIQACSALTGDGLVDGLEWISQRVT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGALVSKFWFMLFPGKDYKIIIVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEAWDVGGQERLRTSWATYYRGTHAVIVVIDSTDRARISIMKDELFRLLGHEDLQHSVVLIFANKQDLKDAMTPAEITDALSLHSIKNHDWHIQACSALTGDGLVDGLEWISQRVTGKAPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ADP-ribosylation factor-like protein 5A Lacks ADP-ribosylation enhancing activity.probableP51646
ADP-ribosylation factor 2 GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.probableP19146
ADP-ribosylation factor-like protein 5A Lacks ADP-ribosylation enhancing activity.probableQ2KJ96

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H17, chain A
Confidence level:very confident
Coverage over the Query: 17-176
View the alignment between query and template
View the model in PyMOL