Citrus Sinensis ID: 030121

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MASENCKIYHERQKLQFCLLHSLNNLFQQEGAFTRASLNEIAEKLVLDYPNKQTWTPLSVVFKPHHNALTGNYDINVLIAALEGRGKSVVWHDRRNEASAIDLDGGENCLMGIVINVPVTRYAGLWKSRHWVALRKIDGVWYNLDSDFHAPQCFKDSKEVREFLDYIIGLGGEVLLVKNDKE
ccccccccEEEEcccccHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEcccccccccccccccccEEEEEEEccccccccccccccEEEEEEEccEEEECcccccccCCcccHHHHHHHHHHHHHcccEEEEEEcccc
*****CKIYHERQKLQFCLLHSLNNLFQQEGAFTRASLNEIAEKLVLDYPNKQTWTPLSVVFKPHHNALTGNYDINVLIAALEGRGKSVVWHDRRNEASAIDLDGGENCLMGIVINVPVTRYAGLWKSRHWVALRKIDGVWYNLDSDFHAPQCFKDSKEVREFLDYIIGLGGEVLLVKND**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASENCKIYHERQKLQFCLLHSLNNLFQQEGAFTRASLNEIAEKLVLDYPNKQTWTPLSVVFKPHHNALTGNYDINVLIAALEGRGKSVVWHDRRNEASAIDLDGGENCLMGIVINVPVTRYAGLWKSRHWVALRKIDGVWYNLDSDFHAPQCFKDSKEVREFLDYIIGLGGEVLLVKNDKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Josephin-2 Cleaves 'Lys-63'-linked poly-ubiquitin chains, and with lesser efficiency 'Lys-48'-linked poly-ubiquitin chains (in vitro). May act as a deubiquitinating enzyme.probableQ9CR30
Josephin-2 Cleaves 'Lys-63'-linked poly-ubiquitin chains, and with lesser efficiency 'Lys-48'-linked poly-ubiquitin chains (in vitro). May act as a deubiquitinating enzyme.probableQ8TAC2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O65, chain A
Confidence level:very confident
Coverage over the Query: 6-117,128-181
View the alignment between query and template
View the model in PyMOL