Citrus Sinensis ID: 030134


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MERILERYERYCYAERQLQANEIEPNGNWTLEYSKLKARMEVLQRNQKHFMGEDLADLSLKELQSVEQQIDSGLKLIRSRKNQLMLQSISELQKKDKLLKEQNNLLAKKVKEKEKLLSQEAQCREQQQQLNHDWNSSNVHLMQTLTNSSYQMGGGSGEEDEDTPTGHRANALLPAWMLRHLH
cHHHHHHHHHccHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc
MERILERYERYCYAERQLQANEIEPNGNWTLEYSKLKARMEVLQRNQKHFMGEDLADLSLKELQSVEQQIDS****IRSRKNQLMLQSISELQKKDKLLKEQNNLLA********************************************************************WMLRHL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERILERYERYCYAERQLQANEIEPNGNWTLEYSKLKARMEVLQRNQKHFMGEDLADLSLKELQSVEQQIDSGLKLIRSRKNQLMLQSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLNHDWNSSNVHLMQTLTNSSYQMGGGSGEEDEDTPTGHRANALLPAWMLRHLH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Agamous-like MADS-box protein AGL8 Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique. Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND.probableQ38876

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 58-125
View the alignment between query and template
View the model in PyMOL
Template: 1K6O, chain B
Confidence level:probable
Coverage over the Query: 1-19
View the alignment between query and template
View the model in PyMOL