Citrus Sinensis ID: 030147


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MGSIAKKGLQQYLIQLQQHPLRTKAITAGVLSAISDIVAQKLTGIQKLQLRRLLLKVLFGCAYLGPFGHFLHLILDKIFKGKKDTSTVAKKVVLEQLTSSPWNNLMFMIYYGVVVEGRPWRDVKTKIKKDYPTVQYTSWTFWPVVGWINHLYVPLQFRVIFHSLVAMCWGIFLNLRALPKAK
ccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccc
****AKKGLQQYLIQLQQHPLRTKAITAGVLSAISDIVAQKLTGIQKLQLRRLLLKVLFGCAYLGPFGHFLHLILDKIFKGKKDTSTVAKKVVLEQLTSSPWNNLMFMIYYGVVVEGRPWRDVKTKIKKDYPTVQYTSWTFWPVVGWINHLYVPLQFRVIFHSLVAMCWGIFLNLRAL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSIAKKGLQQYLIQLQQHPLRTKAITAGVLSAISDIVAQKLTGIQKLQLRRLLLKVLFGCAYLGPFGHFLHLILDKIFKGKKDTSTVAKKVVLEQLTSSPWNNLMFMIYYGVVVEGRPWRDVKTKIKKDYPTVQYTSWTFWPVVGWINHLYVPLQFRVIFHSLVAMCWGIFLNLRALPKAK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisomal membrane protein 2 Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.probableQ07066
Peroxisomal membrane protein 2 Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.probableQ2KIY1
Peroxisomal membrane protein PMP22 May be involved in the metabolism of reactive oxygen species.probableQ9ZS51

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted