Citrus Sinensis ID: 030176


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MGTVVETPVKEADATVTVKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNRNQVRQKLPFSWGVFCLFIMLSFSSCISIPFSYFGHKKI
cccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccHHHHHHcccc
**************TVTVKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIK*****GTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNRNQVRQKLPFSWGVFCLFIMLSFSSCISIPFSYFGHKKI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTVVETPVKEADATVTVKKPTVVFVLGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNRNQVRQKLPFSWGVFCLFIMLSFSSCISIPFSYFGHKKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UMP/CMP kinase Furnishes the cell with pyrimidines. Accepts UMP and CMP as phosphate acceptors with high activity; does not act on dCMP and dUMP.probableO04905
Uridylate kinase Furnishes the cell with pyrimidines. Accepts UMP, and dUMP as phosphate acceptors with high activity; to a lesser extent, it can also use IMP, GMP, dGMP, 5-iodo-dUMP, XMP, and dTMP as substrates. ATP and dATP are the best phosphate donors; can use GTP, dGTP, dCTP, and dTTP to some degree (30-50%).probableP15700
UMP-CMP kinase This UMP-CMP kinase uses preferentially ATP as phosphate donor and is specific for UMP and CMP.probableP20425

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.14Transferred entry: 2.7.4.14.probable
2.7.4.3Adenylate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QF9, chain A
Confidence level:very confident
Coverage over the Query: 20-163
View the alignment between query and template
View the model in PyMOL