Citrus Sinensis ID: 030198

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-

MEITDKKESDINNTQTVADSVDNNNKDAEERQARELKANLHPLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSLLPSPTDLHLFKEGIRPLWEDSANCNGGKWIIRFKKVVSGRFWEDLVLALVGDQLDYGDNICGAVLSIRFNEDILSVWNRNASDHQVCDY

ccccccccccccccccccccccccccHHHHHHHHHcccccccccccEEEEEEccccccccccccHHHccEEEEEccHHHHHHHccccccccccccccEEEEEEccccccccccccccccEEEEEEccccHHHHHHHHHHHHHcccccccccccEEEEEEcccccEEEEEcccccccccccc

***************************************LHPLKNKFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSLLPSPTDLHLFKEGIRPLWEDSANCNGGKWIIRFKKVVSGRFWEDLVLALVGDQLDYGDNICGAVLSIRFNEDILSVWNRNAS*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEITDKKESDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFVFWYTRRTPGVRTQTSYEDNIKKIVDFSTVEGFWVCYCHLARPSLLPSPTDLHLFKEGIRPLWEDSANCNGGKWIIRFKKVVSGRFWEDLVLALVGDQLDYGDNICGAVLSIRFNEDILSVWNRNASDHQVCDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Eukaryotic translation initiation factor NCBP	Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.	probable	Q10NQ9
Eukaryotic translation initiation factor NCBP	Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.	probable	Q9FK59
Eukaryotic translation initiation factor NCBP	Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.	probable	A3RCV9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JGB, chain A
Confidence level:very confident
Coverage over the Query: 36-179
View the alignment between query and template
View the model in PyMOL