Citrus Sinensis ID: 030232


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MMDLSWLSTILFGAGCLAFGYCIGKGCPACFFVSVRRAKNAAVANENKKNKAKEPLEIEKLADILDDFKMVLVVRNDLKMGKGKIAAQCSHATLGLYKKVLYRAPKALNRWEMCAQPKVVLKIESEEDMLVLQERAKSLKLPTHITIDAGRTQIAPNSRTVMAILGPVEVVDDVTGGLKLL
ccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccccHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccccccEEEEEccccHHHHHHccccccc
***LSWLSTILFGAGCLAFGYCIGKGCPACFFVSVRR*************************DILDDFKMVLVVRNDLKMGKGKIAAQCSHATLGLYKKVLYRAPKALNRWEMCAQPKVVLKIESEEDMLVLQERAKSLKLPTHITIDAGRTQIAPNSRTVMAILGPVEVVDDVTGGLKLL
xxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMDLSWLSTILFGAGCLAFGYCIGKGCPACFFVSVRRAKNAAVANENKKNKAKEPLEIEKLADILDDFKMVLVVRNDLKMGKGKIAAQCSHATLGLYKKVLYRAPKALNRWEMCAQPKVVLKIESEEDMLVLQERAKSLKLPTHITIDAGRTQIAPNSRTVMAILGPVEVVDDVTGGLKLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable peptidyl-tRNA hydrolase 2 The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.probableO97067
Peptidyl-tRNA hydrolase 2, mitochondrial The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.probableQ3ZBL5
Peptidyl-tRNA hydrolase 2, mitochondrial Promotes caspase-independent apoptosis by regulating the function of two transcriptional regulators, AES and TLE1.probableQ9Y3E5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.1.-Carboxylic ester hydrolases.probable
3.1.1.29Aminoacyl-tRNA hydrolase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q7S, chain A
Confidence level:very confident
Coverage over the Query: 66-181
View the alignment between query and template
View the model in PyMOL