Citrus Sinensis ID: 030233

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-

MGKLISRLAKRFFPQCRIKLLMVGLDASGKTTILYKMKLGEIVTTTPTIGFNVEAVEYKNKSFCVWDVGGQNKIRALWRHYFRDTLGLTFVVDSSDRERISEARNELHQILSDNELSNAALLVFANKQDLPNVMPTAEVADKLELYSLGQRRWSIQSCSAISGQGLYEGLDWLSNNISVKN

cHHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHccccEEEcccccccEEcEEEEccEEEEEEEcccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHccc

MGKLISRLAKRFFPQCRIKLLMVGLDASGKTTILYKMKLGEIVTTTPTIGFNVEAVEYKNKSFCVWDVGGQNKIRALWRHYFRDTLGLTFVVDSSDRERISEARNELHQILSDNELSNAALLVFANKQDLPNVMPTAEVADKLELYSLGQRRWSIQSCSAISGQGLYEGLDWLSNNIS***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGKLISRLAKRFFPQCRIKLLMVGLDASGKTTILYKMKLGEIVTTTPTIGFNVEAVEYKNKSFCVWDVGGQNKIRALWRHYFRDTLGLTFVVDSSDRERISEARNELHQILSDNELSNAALLVFANKQDLPNVMPTAEVADKLELYSLGQRRWSIQSCSAISGQGLYEGLDWLSNNISVKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ADP-ribosylation factor 1	GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.	probable	O00909
ADP-ribosylation factor 1	GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; required for the sequence-specific vacuolar sorting route to the lytic vacuole, for the ER-to-Golgi transport and for the Golgi-derived transport to the plasma membrane. Involved in the recruitment of COPI and GDAP1 to membranes.	probable	P36397
ADP-ribosylation factor 2	GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.	probable	Q8BSL7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B6H, chain A
Confidence level:very confident
Coverage over the Query: 5-180
View the alignment between query and template
View the model in PyMOL