Citrus Sinensis ID: 030234

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALSA
cHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHcccEEEEcccccHHHHHHHHHHHHcc
MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALSA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVTGEPLIQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKGIVAQLHAEKPPQEVTSEVQKALSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenylate kinase B This small ubiquitous enzyme is essential for maintenance and cell growth.confidentQ08480
Adenylate kinase 1 Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth. Functions both in cytoplasm and mitochondrion intermembrane space.probableQ6FM32
Adenylate kinase 1 Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth. Functions both in the cytoplasm and mitochondrion intermembrane space.probableP07170

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.3Adenylate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TLX, chain A
Confidence level:very confident
Coverage over the Query: 1-180
View the alignment between query and template
View the model in PyMOL